ESTScan Details for Unigene SGN-U616617

Score 
1356
Direction 
Forward
Predicted Peptide Sequence 
MENFPVINMKNLNGDKRASTMEHIKDACENWGFFELVNHGIPHEMMDTVERLTKGHYKKCMEQRFKELVASKALEGVQAEITDMDWESTF
FLRHLPVSNISQVPDLDDEYRTIMKEFAVRLEKLAEELLDLLCENLGLEKGYLKKAFYGSKGPNFGTKVSNYPPCPKPELIKGLRPHTDA
GGIILLFQDDKVSGLQLLKGDQWVDVPPMKHSIVVNLGDQLEVITNGKYKSVLHRVIAQTDGNRMSLASFYNPGNDAVIYPAPALLEKEA
EERKEVYPKFVFDDYMKLYAGLKFQAKEPRFELMKNVEANVTMGPIATA*
Predicted Coding Sequence 
ATGGAGAACTTCCCAGTAATCAACATGAAAAACCTCAATGGTGACAAGAGAGCTTCCACCATGGAGCATATAAAGGATGCTTGTGAAAAC
TGGGGTTTCTTTGAGTTGGTGAACCATGGAATCCCACACGAGATGATGGACACAGTTGAAAGATTGACAAAAGGTCATTACAAGAAATGC
ATGGAGCAAAGGTTCAAGGAGTTGGTGGCAAGCAAGGCTTTAGAGGGTGTACAAGCTGAGATTACGGATATGGATTGGGAGAGCACATTT
TTCTTGCGCCACCTTCCTGTCTCAAACATTTCACAAGTCCCTGATCTAGATGATGAATACAGGACCATCATGAAGGAGTTTGCTGTAAGA
TTAGAAAAACTGGCTGAAGAACTTCTTGATTTACTATGTGAAAATCTTGGTCTTGAGAAGGGCTATTTGAAGAAAGCCTTTTATGGTTCA
AAAGGTCCCAATTTTGGCACCAAGGTTAGCAACTACCCTCCATGTCCCAAGCCAGAATTGATTAAGGGACTTCGACCACACACTGATGCT
GGTGGGATTATCTTGCTTTTCCAAGATGATAAAGTAAGTGGTCTACAACTCCTCAAGGGTGATCAATGGGTTGATGTCCCTCCAATGAAG
CACTCTATTGTGGTCAACCTTGGTGACCAACTCGAGGTGATTACCAATGGAAAATACAAAAGTGTGCTCCACAGAGTCATAGCTCAAACA
GATGGAAATAGGATGTCACTTGCTTCATTCTACAATCCAGGTAATGATGCAGTTATTTATCCAGCACCAGCACTACTGGAAAAAGAAGCA
GAAGAAAGAAAAGAAGTCTACCCAAAATTTGTTTTTGATGACTACATGAAACTCTATGCTGGACTTAAATTCCAGGCCAAAGAGCCAAGA
TTTGAACTCATGAAGAACGTGGAAGCCAATGTTACCATGGGTCCAATTGCAACTGCCTAG
Edits in Original Sequence 
ACTCTAGTCTCCACTCCTGCCAGCTTTCTCCTATCCCTTGCCACCCCAAAATCCAAATCCCACACACAACACACAAACACACAAAATACA
CAACAAAATCCAACTCCCACGCACAAAACACACATTTAGGCAAGAAAAGTAGCCACCACAAAGGCTAATAAG
(5')ATGGAGAACTTCCC
AGTAATCAACATGAAAAACCTCAATGGTGACAAGAGAGCTTCCACCATGGAGCATATAAAGGATGCTTGTGAAAACTGGGGTTTCTTTGA
GTTGGTGAACCATGGAATCCCACACGAGATGATGGACACAGTTGAAAGATTGACAAAAGGTCATTACAAGAAATGCATGGAGCAAAGGTT
CAAGGAGTTGGTGGCAAGCAAGGCTTTAGAGGGTGTACAAGCTGAGATTACGGATATGGATTGGGAGAGCACATTTTTCTTGCGCCACCT
TCCTGTCTCAAACATTTCACAAGTCCCTGATCTAGATGATGAATACAGGACCATCATGAAGGAGTTTGCTGTAAGATTAGAAAAACTGGC
TGAAGAACTTCTTGATTTACTATGTGAAAATCTTGGTCTTGAGAAGGGCTATTTGAAGAAAGCCTTTTATGGTTCAAAAGGTCCCAATTT
TGGCACCAAGGTTAGCAACTACCCTCCATGTCCCAAGCCAGAATTGATTAAGGGACTTCGACCACACACTGATGCTGGTGGGATTATCTT
GCTTTTCCAAGATGATAAAGTAAGTGGTCTACAACTCCTCAAGGGTGATCAATGGGTTGATGTCCCTCCAATGAAGCACTCTATTGTGGT
CAACCTTGGTGACCAACTCGAGGTGATTACCAATGGAAAATACAAAAGTGTGCTCCACAGAGTCATAGCTCAAACAGATGGAAATAGGAT
GTCACTTGCTTCATTCTACAATCCAGGTAATGATGCAGTTATTTATCCAGCACCAGCACTACTGGAAAAAGAAGCAGAAGAAAGAAAAGA
AGTCTACCCAAAATTTGTTTTTGATGACTACATGAAACTCTATGCTGGACTTAAATTCCAGGCCAAAGAGCCAAGATTTGAACTCATGAA
GAACGTGGAAGCCAATGTTACCATGGGTCCAATTGCAACTGCCTAG(3')ACTCATAGGAATAAAACGGTGCTAGGATGTTTTCTTCTCC
CTCTTATGTTTTCTACTTATTATTATTATTATTTTTTTATTGTGGGGGTTGGTGGTTATTCCCAGTCATTTGTTGCTCCAGAGAGGAGGG
TCCTTTATACATCTGAGGGACCAAAATTTATTATGTAGTAAGAATTCTAAGACAAAGAAATAAAATAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan