ESTScan Details for Unigene SGN-U616694

Score 
1357
Direction 
Forward
Predicted Peptide Sequence 
AGTFHRVLGFQTTLPASTFPNSFSTYPEDFLSNLESSNQLFLLNKPSSPAPKELTLPXHILLYYHQDKKKFFFIRFLTWFLAESCIAGSR
KQAKIGKVNNKRKRGEEGKMGLDYYKILGVDKKATDDDMKKAYRKLAMKWHPDKNPNNKKDAEAKFKQISEAYDVLSDPQKRAVYDQYGE
EGLKGGVPPPDTAGGPGGATFFSTGGGPTSFRFNPRSPDDIFSEIFGFSGFGGMRGGSGMRGSRFGGYDXDDSMFSSFEGGGSGPGGSMH
QQTIRKAPAIEQNLPCTLEELYKATTKKMKISREVLDTNSGKIMPVEEILTINIKPGWKKGTKITFPDKGYELPGVAPADLVFIIDEKPH
RVFTREGNDLIVTQKVSLTEALTGYTAHLTTLDGRNLTIPVTSVIHPTYEEVVRGEGMPLPKDPSKKGNLRIKFDIKFPARLTASQKAGI
KELLGS*
Predicted Coding Sequence 
GCTGGAACTTTCCACAGGGTTCTGGGCTTCCAGACGACTCTCCCCGCTTCGACGTTTCCCAATTCCTTTTCTACATATCCTGAGGATTTT
CTTTCCAATTTAGAATCCTCCAACCAACTATTTCTGCTTAATAAACCATCATCACCAGCCCCAAAAGAACTCACTTTACCTXACCACATT
CTTCTTTATTATCATCAAGACAAGAAAAAGTTTTTTTTCATTCGTTTTCTTACTTGGTTTCTTGCCGAAAGTTGTATTGCTGGTTCTAGA
AAACAAGCAAAAATTGGTAAGGTGAATAACAAGAGAAAGAGAGGGGAGGAGGGGAAGATGGGGCTGGATTACTACAAAATATTGGGAGTT
GATAAAAAAGCCACCGATGATGATATGAAGAAGGCTTATCGAAAGCTTGCGATGAAGTGGCATCCGGATAAAAATCCCAATAATAAAAAG
GATGCTGAGGCCAAGTTCAAGCAGATCTCTGAAGCTTATGATGTTCTAAGTGATCCTCAGAAAAGAGCAGTGTATGATCAGTATGGTGAG
GAGGGGTTAAAAGGTGGGGTGCCGCCGCCAGATACTGCTGGTGGCCCTGGTGGCGCTACTTTCTTCTCCACTGGTGGAGGGCCAACTTCA
TTTAGGTTTAATCCTAGGAGTCCAGATGATATTTTTTCTGAGATCTTTGGGTTTTCTGGCTTTGGAGGAATGAGGGGTGGCAGTGGCATG
AGGGGTTCAAGGTTTGGTGGGTATGATXTTGATGATAGCATGTTTTCTTCATTTGAAGGAGGCGGTAGTGGGCCTGGTGGATCAATGCAT
CAACAAACAATTAGAAAAGCACCTGCAATTGAGCAAAACTTGCCTTGCACACTAGAAGAGCTATATAAGGCGACTACCAAGAAAATGAAG
ATCTCCAGAGAAGTTCTTGATACCAATAGTGGCAAGATAATGCCTGTAGAAGAGATTCTTACCATTAACATCAAACCTGGCTGGAAGAAA
GGAACGAAGATCACCTTCCCCGACAAAGGATATGAGCTGCCAGGTGTAGCACCTGCAGATCTTGTGTTCATCATAGATGAGAAACCTCAC
AGGGTGTTTACGCGTGAGGGGAATGACTTGATTGTTACCCAAAAGGTCTCTCTCACTGAAGCATTGACAGGTTATACAGCCCATCTTACT
ACTCTGGATGGTAGGAATCTAACAATTCCCGTCACCAGTGTGATTCACCCAACTTATGAAGAAGTAGTTCGAGGTGAAGGCATGCCGCTT
CCAAAAGATCCATCAAAGAAGGGAAACTTGAGAATTAAGTTTGACATCAAGTTTCCTGCTAGGCTGACTGCGAGTCAGAAGGCTGGTATA
AAGGAACTTTTGGGTTCTTGA
Edits in Original Sequence 
(5')GCTGGAACTTTCCACAGGGTTCTGGGCTTCCAGACGACTCTCCCCGCTTCGACGTTTCCCAATTCCTTTTCTACATATCCTGAGGA
TTTTCTTTCCAATTTAGAATCCTCCAACCAACTATTTCTGCTTAATAAACCATCATCACCAGCCCCAAAAGAACTCACTTTACCTXACCA
CATTCTTCTTTATTATCATCAAGACAAGAAAAAGTTTTTTTTCATTCGTTTTCTTACTTGGTTTCTTGCCGAAAGTTGTATTGCTGGTTC
TAGAAAACAAGCAAAAATTGGTAAGGTGAATAACAAGAGAAAGAGAGGGGAGGAGGGGAAGATGGGGCTGGATTACTACAAAATATTGGG
AGTTGATAAAAAAGCCACCGATGATGATATGAAGAAGGCTTATCGAAAGCTTGCGATGAAGTGGCATCCGGATAAAAATCCCAATAATAA
AAAGGATGCTGAGGCCAAGTTCAAGCAGATCTCTGAAGCTTATGATGTTCTAAGTGATCCTCAGAAAAGAGCAGTGTATGATCAGTATGG
TGAGGAGGGGTTAAAAGGTGGGGTGCCGCCGCCAGATACTGCTGGTGGCCCTGGTGGCGCTACTTTCTTCTCCACTGGTGGAGGGCCAAC
TTCATTTAGGTTTAATCCTAGGAGTCCAGATGATATTTTTTCTGAGATCTTTGGGTTTTCTGGCTTTGGAGGAATGAGGGGTGGCAGTGG
CATGAGGGGTTCAAGGTTTGGTGGGTATGATXTTGATGATAGCATGTTTTCTTCATTTGAAGGAGGCGGTAGTGGGCCTGGTGGATCAAT
GCATCAACAAACAATTAGAAAAGCACCTGCAATTGAGCAAAACTTGCCTTGCACACTAGAAGAGCTATATAAGGCGACTACCAAGAAAAT
GAAGATCTCCAGAGAAGTTCTTGATACCAATAGTGGCAAGATAATGCCTGTAGAAGAGATTCTTACCATTAACATCAAACCTGGCTGGAA
GAAAGGAACGAAGATCACCTTCCCCGACAAAGGATATGAGCTGCCAGGTGTAGCACCTGCAGATCTTGTGTTCATCATAGATGAGAAACC
TCACAGGGTGTTTACGCGTGAGGGGAATGACTTGATTGTTACCCAAAAGGTCTCTCTCACTGAAGCATTGACAGGTTATACAGCCCATCT
TACTACTCTGGATGGTAGGAATCTAACAATTCCCGTCACCAGTGTGATTCACCCAACTTATGAAGAAGTAGTTCGAGGTGAAGGCATGCC
GCTTCCAAAAGATCCATCAAAGAAGGGAAACTTGAGAATTAAGTTTGACATCAAGTTTCCTGCTAGGCTGACTGCGAGTCAGAAGGCTGG
TATAAAGGAACTTTTGGGTTCTTGA(3')GATTGTAACCTGGGTTTTTTTGCTGTTGTTNGGAGTAGTACTTTGTGTATATTTTTCAGAG
CCTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan