ESTScan Details for Unigene SGN-U616800

Score 
173
Direction 
Forward
Predicted Peptide Sequence 
IEADKYGDDVLSAGEVFNQDSLKVLEADIQHANALAAEIPRAKGGARLQMKLVYNHLAPLFLFFFNGWIVPAHXLLPRYLNLFHVLIYKV
YTDGRPRISRHGRKATVNXLLRNYTTITAALHGDLVEVDDATERNCALKNIGKKRLEGGTGFTNFDLEREDXMWNLLRAMYQNGVALTAV
MLCASIATAIGTLGLNLARFVVVAKESQVERFMX
Predicted Coding Sequence 
ATAGAAGCAGATAAGTATGGAGATGATGTATTATCAGCTGGGGAGGTCTTCAATCAGGATTCCCTTAAAGTTCTGGAGGCTGATATACAG
CACGCTAATGCTCTGGCTGCTGAAATTCCTAGAGCAAAAGGCGGAGCGCGCCTTCAAATGAAGTTAGTTTACAATCACTTAGCACCTCTC
TTTCTGTTCTTCTTCAATGGATGGATTGTTCCTGCACATGXTCTGCTTCCAAGATATCTAAATCTTTTCCATGTACTTATCTATAAGGTT
TACACAGATGGGAGACCAAGAATATCTAGACACGGAAGGAAAGCAACTGTTAATGXACTTCTACGCAATTATACTACCATCACTGCAGCA
CTTCATGGAGACTTAGTAGAGGTTGATGATGCAACAGAAAGGAATTGTGCCCTTAAAAACATTGGCAAGAAACGACTGGAAGGCGGTACT
GGATTTACCAACTTCGACTTGGAGAGGGAAGATGAXATGTGGAATCTGCTTAGAGCCATGTACCAAAATGGTGTTGCXCTAACTGCTGTC
ATGCTATGTGCATCAATTGCTACCGCGATTGGAACACTAGGTCTGAATCTTGCCCGTTTTGTCGTGGTAGCAAAAGAGAGTCAAGTCGAG
AGATTTATGGXX
Edits in Original Sequence 
GCTTCGTCTTCGGAAGACTAAAGAATTCCTTAGCAACATAATCATCATTTTCTGTCTGACCAACAAAACCGAAACCTGTCATCCTCAGAG
CCGCCCCTTCCCTTTATCTCAAGAAAAGATGTACTGTACTACTTCGAGAAAGTTATTCGGAGGAGGGGTTTGAAATAGGGAAAGAGAGAG
AGATTAAAAGAATTTCTGTTGCTTCCCATTCTTTTATATTCTTCTCTTGTCCTTACCTTAAGAGTTAAGACTAAACCTTGTGGTTTTCGC
AAGCTCTTTAATTTTCGTGACAGTAAGAGTTCCCTCCTCCTGTCTTTTACTCTTAACTTCCTGATTAAGAGAGAGGCCATTTCTTGATTA
AATACGGAG
(5')ATAGAAGCAGATAAGTATGGAGATGATGTATTATCAGCTGGGGAGGTCTTCAtATCAGGATTCCCTTAAAGTTCTGG
AGGCTGATATACAGCACGCTAATGCTCTGGCTGCTGAAATTCCTAGAGCAAAAGGCGGAGCGCGCCTTCAAATGAAGTTAGTTTACAATC
ACTTAGCACCTCTCTTTCTGTTCTTaCTTCAATGGATGGATTGTTCCTGCACATGXTCTGCTTCCAAGATATCTAAATCTTTTCCATGTA
CTTATCTATAAGGTTTACACAGATGGGAGACCAAGAATATCTAGACACGGAAGGAAAGCAACTGTTAATGXACTTCTACGCAATTATACT
ACCATCACTGCAGCgACTTCATGGAGACTTAGTAGAGGTTGATGATGCAACAGAAAGGAATTGTGCCCTTAAAAACATTGGCAAGAAACG
ACTGGAAGGCGGTACTGGATTTACCAACTTCGACTTGGAGAGGGAAGATGAXATGTGGAATCTGCTTAGAGCCATGTACCAAAATGGTGT
TGCXCTAACTGCTGTCATGCTATGTGCATCAATTGCTACCGCGATTGGAACACTAGGTCTGAATCTTGCCCGTTTTGTCGTGGTAGCAtA
AAGAGAGTCAAGTCGAGAGATTTATGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan