ESTScan Details for Unigene SGN-U616821

Score 
498
Direction 
Forward
Predicted Peptide Sequence 
IIEAQKDSKLKPPSSXVLIVVFLQASQARLIKIPFLRDLLAYRATSKTSVFSAMATTAHNNLNAKLVLLGDMGAGKSSLVLRFVKGQFLE
FQESTIGAAFFSQTVSVNNSTVKFEIWDTAGQERYHSLAPMYYRGAAAAIIVYDITSTVNDVTTTWFDCGYVYXDFFGALGLTGFFARAK
KWVQELQKQGNPNLVMALAGNKADMEDKRNVTAEEARAYADENGLFFIETSAKTAINVNDI
Predicted Coding Sequence 
ATTATTGAAGCCCAAAAAGATTCGAAACTCAAACCTCCCTCTTCTXCTGTTCTAATCGTCGTCTTCCTTCAAGCTTCACAAGCTCGCCTA
ATCAAAATTCCATTTCTACGAGACCTTTTAGCTTACCGCGCCACCTCCAAAACGTCCGTCTTCTCCGCCATGGCAACCACCGCTCACAAT
AATCTCAATGCCAAACTCGTTTTGTTAGGGGATATGGGAGCTGGTAAATCGAGCCTAGTCTTACGCTTTGTAAAGGGCCAATTCCTCGAA
TTTCAAGAATCGACGATCGGAGCGGCGTTTTTCTCGCAAACGGTGTCGGTGAACAATTCGACGGTGAAGTTCGAGATCTGGGACACTGCT
GGCCAAGAACGCTACCACAGCTTGGCCCCCATGTACTACAGGGGCGCTGCTGCTGCTATTATTGTCTATGACATTACTAGCACGGTGAAT
GATGTGACTACCACATGGTTTGACTGTGGTTACGTTTATGXTGACTTTTTTGGAGCTCTTGGCTTGACAGGATTCTTTGCACGGGCTAAG
AAGTGGGTGCAAGAACTTCAGAAGCAAGGTAATCCGAACCTCGTTATGGCGCTTGCTGGAAATAAAGCTGATATGGAAGATAAGAGGAAT
GTGACTGCAGAAGAAGCACGCGCATATGCAGACGAAAATGGTCTTTTTTTCATCGAAACCTCTGCTAAAACTGCTATCAATGTTAATGAT
ATT
Edits in Original Sequence 
(5')ATTATTGAAGCCCAAAAAGATTCGAAACTCAAACCTCCCTCTTCTXCTGTTCTAATCGTCGTCTTCCTTCAAGCTTCACAAGCTCG
CCTAATCAAAATTCCATTTCTACGAGACCTTTTAGCTTACCGCGCCACCTCCAAAACGTCCGTCTTCTCCGCCATGGCAACCACCGCTCA
CAATAATCTCAATGCCAAACTCGTTTTGTTAGGGGATATGGGAGCTGGTAAATCGAGCCTAGTCTTACGCTTTGTAAAGGGCCAATTCCT
CGAATTTCAAGAATCGACGATCGGAGCGGCGTTTTTCTCGCAAACGGTGTCGGTGAACAATTCGACGGTGAAGTTCGAGATCTGGGACAC
TGCTGGCCAAGAACGCTACCACAGCTTGGCCCCCATGTACTACAGGGGCGCTGCTGCTGCTATTATTGTCTATGACATTACTAGCACGGT
GAATGtATGTGACTACCACATGGTTTGACTGTGGTTACGTTTATGXTGACTTTTTTGGAGCTCTTGGCTTGACAGGATTCaTTTGCACGG
GCTAAGAAGTGGGTGCAAGAACTTCAGAAGCAAGGTAATCCGAACCTCGTTATGGCGCTTGCTGGAAATAAAGCTGATATGGAAGATAAG
AGGAATGTGACTGCAGAAGAAGCACGCGCATATGCAGACGAAAATGGTCTTTTTTTCATCGAAACCTCTGCTAAAACTGCTATCAATGTT
AATGATATT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan