ESTScan Details for Unigene SGN-U616903

Score 
268
Direction 
Forward
Predicted Peptide Sequence 
XLIQSLATRNSIVALDELGRGTSTSDGQAIAESVLDHFAHRVHCRGMFSTHYHRLAIDYERDPKVSLFHMACQVGRGIEGLEDVTFLYRL
TPGACPKSYGVNVARLAGLPDAVLQKATLKSRDFEETYGRIKGPKDIFSTHRKEELKNVMKNFQPLWPTTVAIKGGFYASRTARKSKVTS
RTKLKRQSLHCVVQYWLLLITWNEAQPAIGHFAPVLRYLFGVDFSPVAXVIVSKIAAIPRFTCFDLESXVADLWKRQRLRSKSHAEVCFS
ATFLTVPGWAHLXVRIEMDGNDFEGLFCLSLAISKPTKRLFAVRIYLTVGVTGAGGMICGIYFHLLFHLIYLASRESIADLIDCLIAXRV
TKDRAGEKVTRRIVKTLGSDCYCSSHLISVAVCREKLGTFLLQKPEKDVKWSVKSW
Predicted Coding Sequence 
XGGTTAATACAGTCATTGGCAACTAGAAATTCAATTGTTGCATTGGATGAGCTTGGACGAGGAACGTCAACTTCAGATGGACAAGCAATA
GCTGAATCTGTTCTTGATCACTTTGCCCACAGGGTACATTGTCGAGGAATGTTCTCTACTCATTATCATCGATTGGCTATTGACTATGAG
AGAGATCCCAAGGTTTCCCTGTTTCACATGGCATGCCAAGTTGGCAGAGGAATTGAAGGTCTGGAGGATGTTACATTTCTTTACAGGTTG
ACCCCTGGTGCGTGCCCCAAAAGTTATGGTGTCAATGTTGCAAGGCTAGCTGGACTTCCTGATGCTGTGCTCCAAAAGGCCACATTGAAG
TCTCGAGATTTTGAGGAAACCTATGGGAGAATAAAGGGACCGAAGGACATATTTTCAACTCATCGGAAAGAGGAGCTGAAAAATGTGATG
AAGAATTTTCAACCATTGTGGCCAACAACAGTTGCCATCAAAGGCGGTTTCTACGCTAGCCGAACTGCAAGGAAAAGCAAGGTTACTTCT
AGAACGAAGTTAAAAAGGCAATCACTCCATTGTGTTGTACAGTATTGGCTTCTTCTGATTACTTGGAATGAGGCACAACCGGCCATTGGC
CACTTTGCXCCAGTTCTGAGATATTTATTCGGAGTTGATTTCTCACCAGTTGCTXTGGTTATTGTTTCGAAAATTGCTGCTATTCCACGT
TTTACCTGTTTTGACCTTGAAAGTGXTGTAGCGGACTTGTGGAAGCGGCAGCGCTTGCGGTCTAAATCACACGCAGAAGTTTGTTTCAGC
GCAACCTTTTTGACTGTACCTGGCTGGGCCCATCTTAXGGTGCGTATCGAAATGGACGGGAATGACTTTGAAGGGTTATTTTGTCTTTCC
CTTGCCATCTCAAAACCAACAAAAAGGTTGTTTGCGGTGAGGATCTATCTGACGGTCGGGGTTACTGGAGCCGGGGGCATGATTTGTGGA
ATTTACTTTCATTTGTTGTTCCATCTCATTTACCTTGCATCAAGGGAATCTATAGCTGATTTGATTGATTGTTTGATTGCTXCACGAGTA
ACAAAGGACAGAGCCGGGGAGAAAGTAACAAGGAGGATTGTCAAGACACTTGGGAGCGACTGCTACTGCTCATCTCATCTCATCTCCGTT
GCTGTCTGTCGTGAAAAACTGGGTACGTTTCTCCTTCAGAAACCTGAAAAAGATGTGAAATGGAGTGTGAAGTCGTGG
Edits in Original Sequence 
(5')XGGTTAATACAGTCATTGGCAACTAGAAATTCAATTGTTGCATTGGATGAGCTTGGACGAGGAACGTCAACTTCAGATGGACAAGC
AATAGCTGAATCTGTTCTTGATCACTTTGCCCACAGGGTACATTGTCGAGGAATGTTCTCTACTCATTATCATCGATTGGCTATTGACTA
TGAGAGAGATCCCAAGGTTTCCCTGTTTCACATGGCATGCCAAGTTGGCAGAGGAATTGAAGGTCTGGAGGATGTTACATTTCTTTACAG
GTTGACCCCTGGTGCGTGCCCCAAAAGTTATGGTGTCAATGTTGCAAGGCTAGCTGGACTTCCTGATGCTGTGCTCCAAAAGGCCACATT
GAAGTCTCGAGATTTTGAGGAAACCTATGGGAGAATAAAGGGACCGAAGGACATATTTTCAACTCATCGGAAAGAGGAGCTGAAAAATGT
GATGAAGAATTTaTCAACCATTGTGGCCAACAACAGTTGCCATCAAAGtGCGGTTTCTACGCTAGCCGAACTGCAAGGAAAAGCAAGGTT
ACTTCTAGAACGAAGTTAAAAAGGCAATCACTCCATTGTGTTGTACAGTATTGGCTTCTTCTGATTACTTGGAATGAGGCACAACCGGCC
ATTGGCCACTTTGCXCCAGTTCTGAGATATTTATTCGGcAGTTGATTTCTCACCAGTTGCTXTGGTTATTGTTTCGAAAATTGCTGCTAT
TCCACGTTTTACCTGTTTTGACCTTGAAAGTGXTGTAGCGGACTTGTGGAAGCGGCAGCGCTTGCGGTCTAAATCACACGCAGAAGTTTG
TTTCAGCGCAACCTTTTTGACTGTACCTGGCTGGGCCCATCTTAXGGTGCGTATCGAAATGGACGGGAATGACTTTGAAGGGTTATTTTG
TCTTTCCCTTGCCATCTCAAAACCAACAAAAAGGTTGTTTGCGGTGAGGATCTATCTGACGGTCGGGGTTACTGGAGCCGGGGGCATGAT
TTGTGGAATTTACTTTCATTTGTTGTTCgCATCTCATTTACCTTGCATCAAGGGAATCTATAGCTaGATTTGATTGATTGTTTGATTGCT
XCACGAGTAACAAAGGACAGAGCCGGGGAGAAAGTAACAAGGAGGATTGTCAAGACACTTGGGAGCGACTGCTACTGCTCATCTCATCTC
ATCTCCGTTGCTGTCTGTCGTGAAAAACTGGGTACGTTTCTCCTTCAGAAACCTGAAAAAGATGTGAAATGGAGTGTGAAGTCGTGG(3')
TTCTTATAGCTTGTGTTGTTGGGTGTGTTCAGATGCATTGGTCTGTGTGTATGGTTTGTGTTCTCCTGTTTGGTCATTTCACTCTATAA
AAGTAAAGTAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan