ESTScan Details for Unigene SGN-U617160

Score 
908
Direction 
Forward
Predicted Peptide Sequence 
MALPNQQTVDYPSFKLVIVGDGGTGKTTFVKRHLTGEFEKKYEPTIGVEVHPLDFFTNCGKIRFYCWDTAGQEKFGGLRDGYYIHGQCAI
IMFDVTARLTYKNVPTWHRDLCRVCENIPIVLCGNKVDVKNRQVKAKQVTFHRKKNLQYYEISAKSNYNFEKPFLYLARKLAGDPNLHFV
ESPALLPPEVQIDLVAQQQHEAELAQAAAQPLPDDDDDTFEKEQLDGAWSASVMEFVAFFIDRFPCHL*
Predicted Coding Sequence 
ATGGCGCTGCCGAATCAGCAGACCGTGGATTATCCCAGTTTCAAGCTTGTAATTGTTGGTGACGGTGGAACTGGGAAAACTACATTTGTG
AAGAGGCATCTTACTGGTGAATTTGAGAAGAAATATGAACCAACTATTGGTGTGGAAGTTCATCCATTGGACTTCTTTACAAACTGTGGG
AAGATTCGTTTCTATTGCTGGGATACAGCTGGACAGGAGAAATTTGGTGGGCTTCGGGATGGATACTATATCCATGGACAATGTGCTATA
ATCATGTTTGATGTAACAGCTCGATTAACGTACAAGAATGTTCCTACGTGGCACCGTGATCTTTGTCGGGTTTGCGAGAACATACCAATT
GTACTTTGTGGAAACAAGGTTGATGTGAAGAATAGGCAAGTGAAGGCAAAGCAGGTTACCTTCCACCGCAAAAAGAACTTGCAGTACTAT
GAGATTTCAGCAAAGAGCAATTACAACTTTGAGAAGCCTTTCCTATATCTTGCAAGGAAACTCGCTGGGGACCCTAACTTGCATTTTGTC
GAGTCCCCTGCCCTTTTACCCCCCGAGGTTCAGATTGACTTGGTTGCACAGCAACAGCATGAGGCTGAGCTTGCTCAAGCTGCTGCTCAG
CCACTCCCTGACGACGATGATGACACTTTCGAGAAGGAGCAGCTGGATGGAGCTTGGAGTGCCTCTGTTATGGAATTTGTGGCATTTTTC
ATCGATAGGTTTCCTTGCCATCTATAG
Edits in Original Sequence 
CTTTCCTCCTTCCCAAATATTTTCCGCAGCCCAAAATTCCAAACCCCAATTCCTGATTATATCGTTCCTCTCCGCTTTCGCAGCAATTCG
ATTCTGATCTTCATCA
(5')ATGGCGCTGCCGAATCAGCAGACCGTGGATTATCCCAGTTTCAAGCTTGTAATTGTTGGTGACGGTGGAA
CTGGGAAAACTACATTTGTGAAGAGGCATCTTACTGGTGAATTTGAGAAGAAATATGAACCAACTATTGGTGTGGAAGTTCATCCATTGG
ACTTCTTTACAAACTGTGGGAAGATTCGTTTCTATTGCTGGGATACAGCTGGACAGGAGAAATTTGGTGGGCTTCGGGATGGATACTATA
TCCATGGACAATGTGCTATAATCATGTTTGATGTAACAGCTCGATTAACGTACAAGAATGTTCCTACGTGGCACCGTGATCTTTGTCGGG
TTTGCGAGAACATACCAATTGTACTTTGTGGAAACAAGGTTGATGTGAAGAATAGGCAAGTGAAGGCAAAGCAGGTTACCTTCCACCGCA
AAAAGAACTTGCAGTACTATGAGATTTCAGCAAAGAGCAATTACAACTTTGAGAAGCCTTTCCTATATCTTGCAAGGAAACTCGCTGGGG
ACCCTAACTTGCATTTTGTCGAGTCCCCTGCCCTTTTACCCCCCGAGGTTCAGATTGACTTGGTTGCACAGCAACAGCATGAGGCTGAGC
TTGCTCAAGCTGCTGCTCAGCCACTCCCTGACGACGATGATGACACTTTCGAGtAAGGAGCAGCTGGATGGAGCTTGGAGTGCCTCTGTT
ATGGAATTTGTGGCATTTTTCATCGATAGGTTTCCTTGCCATCTATAG(3')GTTTCCAGAATTTTGTCTCCATATTAGAAAGTATCGAG
GGATTTTTCATCGATCAGTTTAGGAATTTTCAAACTTCCTGATGTTTTGCCTTGATTTGTTTGTGAGAAGGACCCGATGTGGTTACTCAG
TTAAAGATACGGTGGACTATTGTTTGTATGAACTAAGACTGCATGCAGAATTTTAGTTTTTTCATGTATTAAAGGTGCATTTCGTCTTAT
AATTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan