ESTScan Details for Unigene SGN-U617164

Score 
270
Direction 
Forward
Predicted Peptide Sequence 
GELKRIEKKSSKARNEEEEVEEESHGGDRGENAGEFYLRYYVGHKGKFGHEFLEFEFRPDGKLRYANNSNYKNDTMIRKEVFVTPAVLKE
CRRIVVESEIMKEDDNNWPEPDRVGRQELEIVMGNEHISFTTAKIGSLVDVNTSKDPEGLRIFYYLVXGFEVFRVFSYLTPLQDQTHLSA
AISPPGTEGKPCVLKLLGLLSFALISSLYI*
Predicted Coding Sequence 
GGAGAATTAAAAAGAATTGAGAAAAAATCATCTAAGGCTAGGAACGAAGAAGAGGAGGTGGAGGAAGAGAGTCATGGCGGAGACAGGGGA
GAAAATGCAGGGGAGTTTTACTTGAGGTACTATGTCGGCCACAAGGGTAAATTCGGGCATGAGTTCTTGGAGTTCGAGTTTAGGCCCGAC
GGCAAGCTGCGGTATGCTAATAATTCCAACTATAAGAACGACACCATGATCCGTAAAGAGGTCTTCGTCACCCCCGCCGTTCTAAAAGAA
TGCCGTCGCATCGTCGTTGAAAGCGAGATAATGAAGGAAGATGACAACAATTGGCCAGAACCAGATCGCGTTGGAAGGCAAGAGCTGGAG
ATTGTAATGGGGAACGAGCACATATCTTTTACCACTGCTAAGATTGGTTCTCTCGTGGATGTCAATACCAGTAAAGATCCTGAAGGTCTT
CGAATCTTCTATTATCTTGTTXCAGGATTTGAAGTGTTTCGTGTTTTCTCTTATCTCACTCCACTTCAAGATCAAACCCATTTGAGTGCA
GCCATATCACCCCCTGGAACAGAAGGAAAGCCATGTGTTTTGAAGTTGCTTGGTCTGTTGTCCTTTGCCTTGATAAGTTCGTTATATATT
TAA
Edits in Original Sequence 
(5')GGAGAATTAAAAAGAATTGAGAAAAAATCATCTAAGGCTAGGAACGAAGAAGAGGAGGTGGAGGAAGAGAGTCATGGCGGAGACAG
GGGAcGAAAATGCAGGGGAGTTTTACTTGAGGTACTATGTCGGCCACAAGGGTAAATTCGGGCATGAGTTCTTGGAGTTCGAGTTTAGGC
CCGACGGCAAGCTGCGGTATGCTAATAATTCCAACTATAAGAACGACACCATGATCCGTAAAGAGGTCTTCGTCACCCCCGCCGTTCTAA
AAGAATGCCGTCGCATCGTCGTTGAAAGCGAGATAATGAAGGAAGATGACAACAATTGGCCAGAACCAGATCGCGTTGGAAGGCAAGAGC
TGGAGATTGTAATGGGGAACGAGCACATATCTTTTACCACTGCTAAGATTGGTTCTCTCGTGGATGTCAATACCAGTAAAGATCCTGAAG
GTCTTCGAATCTTCTATTATCTTGTTXCAGGATTTGAAGTGTTTCGTGTTTTCTCTTATCTCACTCCACTTCAAGATCAAACCCATTTGA
GTGtCAGCCATATCACCCCCTGGAACAGAAGGAAAGCCATGTGTTTTGAAGTTGCTTGGTCTGTTGTCCTTTGCCTTGATAAGTTCGTTA
TATATTTAA(3')ACTTATAAATAGCGTTGATTTGGGTGATTGTTCAAGTAGATGAAGTTTGTGATATGCTAGTTGTGTAATTGAATATC
TATTCCTTTTGCTCTTGATAAGCCCTCTTTTCCGCATTAATCAGTGGATCTTCAGGCTTGAGCCTAGGTTGACTCGCATCTGATCAGCTC
CTCCTTCCTGTTTCTAATTTAAGACGTGATTATTGCATCTTGGAGGTGGTGTAGGTATTGTGTTAGTTTTAAAGGGTGAATTGTGTAACG
CAAAACAAATCTAGTGATGAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan