ESTScan Details for Unigene SGN-U617510

Score 
114
Direction 
Forward
Predicted Peptide Sequence 
DRSPCNCNLYPRLSTLPIPXPKTLKPVFPKACKSQYQTERGLQFDIGDSFFRHESATGRDFGVLSAALYKQSXWQSSSSRRPMWMWNSVP
QVLSRGKTDFVLANDANENYRGDYFGKFVPDFGRKMGCDELDANRVMTERYLEKDYFDLVDVDSFGSDSSFLRAAIGAVKLDGLLYITST
DGYSSGGHRPQHSLAAYGAYVRPMPYSNEVGLRMLIGGALREASVLGYHVVPLFSYYSYHGPVFRAMLQIKRGRLPDAAPITSSATAFSV
EILKQFLGINLVRSDAPASLMHVFPT
Predicted Coding Sequence 
GATCGCTCCCCCTGCAACTGCAACCTCTATCCCCGCCTTTCTACCCTCCCAATTCCCAAXCCTAAAACCCTAAAACCCGTTTTTCCCAAA
GCCTGCAAATCTCAATACCAAACCGAAAGGGGTCTTCAGTTTGACATCGGAGACAGCTTCTTCCGCCATGAGAGCGCCACCGGTCGTGAC
TTCGGTGTTCTCTCGGCAGCCCTCTATAAGCAATCCAAXTGGCAGTCTTCGAGTTCTCGACGCCCTATGTGGATGTGGAATTCGGTCCCT
CAGGTACTTAGTAGAGGCAAAACCGACTTCGTGTTAGCTAATGACGCAAATGAAAACTATAGAGGXGATTATTTCGGGAAATTTGTCCCG
GATTTCGGAAGAAAGATGGGTTGTGATGAATTGGATGCCAATAGAGTAATGACGGAGCGTTATCTGGAAAAGGATTATTTTGACCTGGTC
GATGTTGACTCGTTTGGAAGTGATTCTAGCTTCTTGAGAGCTGCTATTGGGGCTGTCAAATTGGACGGTTTGTTGTATATTACTTCTACT
GATGGCTACTCATCCGGTGGCCACCGCCCTCAACATTCTTTGGCTGCATATGGAGCATATGTTCGGCCAATGCCATACTCAAATGAGGTT
GGTTTGCGGATGCTTATAGGCGGGGCGCTTAGGGAGGCTTCCGTGCTTGGTTACCATGTTGTGCCGTTGTTTTCCTACTACTCGTATCAC
GGCCCTGTTTTTAGAGCAATGCTTCAAATTAAGCGTGGAAGGCTTCCTGATGCAGCACCTATAACTTCATCAGCTACTGCATTCAGTGTG
GAAATTCTCAAACAGTTTCTTGGGATCAACTTGGTCAGATCAGATGCCCCTGCATCACTAATGCATGTGTTCCCAACT
Edits in Original Sequence 
(5')GATCGCTCCCCCTGCAACTGCAACCTCTATCCCCGCCTTTCTACCCTCCCAATTCCCAAXCCTAAAACCCTAAAACCCGTTTTTCC
CAAAGCCTGCAAATCTCAATACCAAACCGAAAGGGGTCTTCAGTTTGACATCGGAGACAGCTTCTTCCGCCATGAGAGCGCCACCGGTCG
TGACTTCGGTGTTCTCTCGGCAGCCCTCTATAAGCAATCCAAXTGGCAGTCTTCGAGTTCTCGACGCCCTATGTGGATGTGGAATTCGGT
CCCTCAGGTACTTAGTAGAGGCAAAAgCCGACTTCGTGTTAGCTAATGACGCAAATGAAAACTATAGAGGXGATTATTTCGGGAAATTTG
TCCCGGATTTCGGAAGAAAGATGGGTTGTGATGAATTcGGATGCCAATAGAGTAATGACGGAGCGTTATCTGGAAAAGGATTATTTTGAC
CTGGTCGATGTTGACTCGTTTGGAAGTGATTCTAGCTTCTTGAGAGCTGCTATTGGGGCTGTCAAATTGGACGGTTTGTTGTATATTACT
TCTACTGATGGCTACTCATCCGGTGGCCACCGCCCTCAACATTCTTTGGCTGCATATGGAGCATATGTTCGGCCAATGCCATACTCAAAT
GAGGTTGGTTTGCGGATGCTTATAGGCGGGGCGCTTAGGGAGGCTTCCGTGCTTGGTTACCATGTTGTGCCGTTGTTTTCCTACTACTCG
TATCACGGCCCTGTTTTTAGAGCAATGCTTCAAATTAAGCGTGGAAGGCTTCCTGATaGCAGCACCTATAACTTCATCAGCTACTGCATT
CAGTGTGGAAATTCTCAAACAGTTTCTTGGGATCAACTTGGTCAGATCAGATGCCCCTGCATCACTAATGCATGTGTTCCCAACT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan