Notice: SGN will be briefly unavailable for maintenance. Apologies.

ESTScan Details for Unigene SGN-U617727

Score 
763
Direction 
Forward
Predicted Peptide Sequence 
VLLGVYFVTNLILAVVYDSFKNELVKQVAEKDRLRIRTLSKAFTLADTYNLGFIDKDQCIRLFEELNKYRTLPKISKEDFELIFDELDDS
HDFKINLNEFADLCNAIALRFQKENSEPIFEKCPSIYHSPVSERLKNFVRSPTFGYIVAFILVLNLVAVIIETTLDIEDNSAQQAWQKVE
FVFGWIYVLEMLLKIYAYGFENYWRDGQNRFDFIVTLVIVVGETATFVAPNRLTFLSNGEWIRYXSHFENAKIDKASDECSTIPSFCCHL
LDPHTKSDAXTWEPYFVSCAFTAQLAYRYLAGIVNAGNPKLESTDLADNNYLLFNFNDYPNGXGHTLQFTGDGELASVX
Predicted Coding Sequence 
GTGCTTCTCGGTGTTTACTTCGTCACCAATTTGATCCTTGCCGTTGTTTACGATAGCTTTAAAAATGAGCTTGTAAAACAAGTGGCTGAA
AAGGATCGTTTGAGGATAAGAACACTGAGCAAAGCTTTTACTCTGGCTGATACCTATAATCTTGGATTCATTGACAAAGATCAGTGCATC
CGACTGTTTGAAGAGCTGAACAAATACAGAACATTACCAAAGATATCCAAGGAAGATTTCGAACTAATATTTGATGAGTTGGATGATAGT
CATGACTTCAAGATTAATTTGAACGAATTTGCTGATCTTTGCAATGCCATAGCACTGAGATTTCAAAAGGAGAATTCAGAACCGATCTTT
GAAAAATGTCCATCAATCTATCATTCGCCAGTTTCTGAGAGATTGAAGAACTTTGTTCGAAGCCCTACATTTGGATATATCGTAGCATTC
ATTCTTGTCTTGAATCTTGTTGCTGTCATTATTGAGACAACGCTTGATATAGAGGACAATTCTGCTCAACAGGCTTGGCAGAAGGTTGAA
TTCGTCTTTGGTTGGATTTATGTCCTGGAGATGCTGTTGAAAATTTATGCTTATGGTTTTGAAAACTATTGGAGGGATGGTCAAAATCGC
TTTGATTTTATTGTCACCTTGGTGATAGTTGTTGGAGAAACGGCCACTTTTGTGGCTCCCAACAGGCTGACTTTTCTTTCAAATGGGGAA
TGGATCCGCTATXCTTCTCATTTTGAGAATGCTAAGATTGATAAGGCTTCTGATGAATGTTCCACAATACCGAGCTTTTGTTGCCACCTT
CTTGACCCTCATACCAAGTCTGATGCCATXACTTGGGAACCATATTTTGTGTCATGTGCATTTACTGCTCAATTGGCGTACAGGTATTTG
GCGGGGATTGTGAATGCTGGCAACCCCAAGTTGGAGAGCACTGATCTTGCTGATAACAACTATTTACTCTTTAACTTCAACGATTACCCG
AATGGAXATGGTCACACTCTTCAATTTACTGGTGATGGGGAACTGGCAAGTGTGGAX
Edits in Original Sequence 
GGCATACAAGGCCTCCCGTTGGTATTGCCTTTTTTTTGTTCTTTTT(5')GTGCTTCTCGGTGTTTACTTCGTCACCAATTTGATCCTTG
CCGTTGTTTACGATAGCTTTAAAAATGAGCTTGTAAAACAAGTGGCTGAAAAGGATCGTTTGAGGATAAGAACACTGAGCAAAGCTTTTA
CTCTGGCTGATACCTATAATCTTGGATTCATTGACAAAGATCAGTGCATCCGACTGTTTGAAGAGCTGAACAAATACAGAACATTACCAA
AGATATCCAAGGAAGATTTCGAACTAATATTTGATGAGTTGGATGATAGTCATGACTTCAAGATTAATTTGAACGAATTTGCTGATCTTT
GCAATGCCATAGCACTGAGATTTCAAAAGGAGAATTCAGAACCGATCTTTGAAAAATGTCCATCAATCTATCATTCGCCAGTTTCTGAGA
GATTGAAGAACTTTGTTCGAAGCCCTACATTTGGATATATCGTAGCATTCATTCTTGTCTTGAATCTTGTTGCTGTCATTATTGAGACAA
CGCTTGATATAGAGGACAATTCTGCTCAACAGGCTTGGCAGAAGGTTGAATTCGTCTTTGGTTGGATTTATGTCCTGGAGATGCTGTTGA
AAATTTATGCTTATGGTTTTGAAAACTATTGGAGGGATGGTCAAAATCGCTTTGATTTTATTGTCACCTTGGTGATAGTTGTTGGAGAAA
CGGCCACTTTTGTGGCTCCCAACAGGCTGACTTTTCTTTCAAATGGGGAATGGATCCGCTATXCTTCTCATTTTGAGAATGCTAAGATTG
ATAAGGCTTCTGATGAATGTTCCACAATACCGAGCTTTTGTTGCCACCTTCTTGACCCTCATACCAAGTCTGATGCCATXACTTGGGAAC
CATATTTTGTGTCATGTGCATTTACTGCTCAATTGGCGTACAGGTATTTGGCGGGGATTGTGAATGCTGGCAACCCCAAGTTGGAGAGCA
CTGATCTTGCTGATAACAACTATTTACTCTTTAACTTCAACGATTACCCGAATGGAXATGGTCACACTCTTCAATTTACTGGTGATGGGG
AACTGGCAAGTGTGGAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan