ESTScan Details for Unigene SGN-U617771

Score 
420
Direction 
Forward
Predicted Peptide Sequence 
QGFEDVFVGLVLRNIGLARTVAKGGKILFLGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGQIKFKAFDLGGHQIARRVWKDYYA
KVDAVVYLVDAYDKERFAESKKELDALLSDESLANVPFLILGNKIDIPYAASEDELRYHMGLTGITTGKGKVNLADSNVRPLEVFMCSIV
PKWVMEKASNGCLNI*
Predicted Coding Sequence 
CAAGGATTCGAAGATGTTTTTGTTGGATTGGTTCTACGGAATATTGGCCTCGCTAGGACTGTGGCAAAAGGAGGCAAGATCTTGTTTCTG
GGCCTCGATAATGCCGGCAAAACCACCTTGCTTCATATGTTGAAAGATGAGAGATTGGTTCAACATCAGCCAACGCAGTACCCGACGTCT
GAGGAGCTGAGTATTGGCCAAATTAAGTTTAAGGCTTTTGACTTGGGAGGCCATCAGATCGCTCGCAGAGTCTGGAAAGATTATTATGCC
AAGGTGGATGCAGTTGTTTATCTCGTGGATGCTTATGACAAAGAAAGGTTTGCAGAATCAAAGAAAGAGCTGGATGCTCTTCTCTCTGAT
GAGTCCTTGGCAAATGTCCCTTTCCTTATTCTGGGGAACAAGATAGACATTCCTTATGCAGCTTCTGAGGACGAGCTGCGTTACCACATG
GGCCTGACAGGCATCACTACTGGAAAGGGCAAGGTAAACTTGGCAGACTCAAATGTCCGTCCCCTTGAGGTCTTCATGTGCAGCATTGTG
CCAAAATGGGTTATGGAGAAGGCTTCAAATGGATGTCTCAATATATAA
Edits in Original Sequence 
GCTTTCTTTCTCTCTCTAAATCAGCGCACAGTAAATTTAGCCCAATTTTTTCCCACCCTCTAAATTCGCCTTCCTTTGATTCTCTCTTCT
CTTGTCGTCCATCGATCCGACTGGTGAGGTTTATTTTTGTAGGGATCGGAGGTGGATTAGGGAAATTGGGGGTGATTAATTGAGGAATTT
TGAGGTGAATTATAATTA
(5')CAAGGATTCGAAGATGTTTTTGTTGGATTGGTTCTACGGAATATTGGCCTCGCTAGGACTGTGGCAAA
AGGAGGCtAAGATCTTGTTTCTGGGCCTCGATAATGCCGGCAAAACCACCTTGCTTCATATGTTGAAAGATGAGAGATTGGTTCAACATC
AGCCAACGCAGTACCCGACGTCTGAGGAGCTGAGTATTGGCCAAATTAAGTTTAAGGCTTTTGACTTGGGAGGCCATCAGATCGCTCGCA
GAGTCTGGAAAGATTATTATGCCAAGGTGGATGCAGTTGTTTATCTCGTGGATGCTTATGACAAAGAAAGGTTTGCAGAATCAAAGAAAG
AGCTGGATGCTCTTCTCTCTGATGAGTCCTTGGCAAATGTCCCTTTCCTTATTCTGGGGAACAAGATAGACATTCCTTATGCAGCTTCTG
AGGACGAGCTGCGTTACCACATGGGCCTGACAGGCATCACTACTGGAAAGGGCAAGGTAAACTTGGCAGACTCAAATGTCCGTCCCCTTG
AGGTCTTCATGTGCAGCATTGTGCgCAAAATGGGTTATGGAGAAGGCTTCAAATGGATGTCTCAATATATAA(3')AGTAGTGGGCTTTA
GTGGGGGGTGAGAAAGAGAGCTGTTTTTTCTTTTAAAATGTAACTCCTGCCAAAATGGAGTAGAACAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan