ESTScan Details for Unigene SGN-U618341

Score 
369
Direction 
Forward
Predicted Peptide Sequence 
MATLHAISLKSSISPFSLSHQGKVFLVNGVFCAPAGFQKLRKKEFWKPNQEIEPENLDQKEAYVSCNVKESDDQSNGEEPPESLFMKKLK
RRGMTPASLLEEKTNSGYVGQETTSREEDGGFSRANAVSTNPERNQPIKENNLWHSNSEGLEGLIPRAXTFAYAWRNILFGVLAIDPHNF
CLLLYSLPVFRTKFRP*
Predicted Coding Sequence 
ATGGCGACTTTACATGCTATATCATTAAAATCGAGCATTTCTCCATTTTCACTTTCTCATCAAGGCAAGGTTTTCCTTGTAAATGGAGTT
TTCTGTGCTCCAGCTGGATTCCAGAAACTCAGGAAGAAAGAATTTTGGAAGCCGAATCAAGAAATTGAGCCTGAGAATCTTGATCAGAAG
GAGGCTTACGTTTCCTGTAACGTTAAAGAGAGCGATGATCAAAGCAATGGGGAAGAACCTCCTGAGTCATTGTTTATGAAAAAATTAAAG
AGGCGGGGCATGACTCCTGCTTCATTGCTTGAGGAAAAAACTAATAGCGGATATGTAGGTCAAGAAACAACCTCCAGGGAAGAAGATGGA
GGTTTCTCGCGAGCAAATGCTGTGTCTACTAATCCTGAGAGAAACCAACCAATCAAAGAGAACAATCTATGGCACTCTAATAGTGAAGGC
CTTGAGGGTTTAATTCCACGGGCCATXACTTTTGCTTACGCTTGGAGGAACATTCTTTTTGGGGTTTTGGCCATTGATCCTCATAACTTT
TGCCTTCTTCTCTACTCTCTACCTGTATTTCGGACCAAATTTCGTCCATGA
Edits in Original Sequence 
CTTCCTACAAAAAAGTCCGTGTTGAACTTCCTATTCCACTAAATTCCAATTCTCCGATCAGATTCCGATAAAAAAAA(5')ATGGCGACT
TTACATGCTATATCATTAAAATCGAGCATTTCTCCATTTTCACTTTCTCaATCAAGGCAAGGTTTTCCTTGTAAATGGAGTTTTCTGTGC
TCCgAGCTGGATTCCAGAAACTCAGGAAGAAAGAATTTTGGAAGCCGAATCAAGAAATTGAGCCTGAGAATCTTGATCAGAAGGAGGCTT
AgCGTTTCCTGTAACGTTAAAGAGAGCGATGATCAAAGCAATGGGGAAGAACCTCCTGAGTCATTGTTTATGAAAAAATTAAAGAGGCGG
GGCATGACTCCTGCTTCATTGCTTGAGGAAAAAACTAATAGCGGATATGTAGGTCAAGAAACAACCTCCAGGGAAGAAGATGGAGGTTTC
TCGCGAGCAAATGCTGTGTCTACTAATCCTGAGAGAAACCtAACCAATCAAAGAGAACAATCTATGGCACTCTAATAGTGAAGGCCTTGA
GGGTTTAATTCCACGGGCCATXACTTTTGCTTACGCTTGGAGGAACATTCTTTTTGGGGTTTTGGCCATTGATCCTCATAACTTTTGCCT
TCTTCTCTACTCTCTACCTGTATTTCGGACCAAATTTCGTCCATGA(3')CGCAGGGAACACTCGTGTCACGCCACCCGAGTACATTGAT
CCCTATCAGCTTCTTGAAAAAAAAAGAATTTCGTCCACAGCGCCTCGTCTAAACTGATGGACTAAATTGCTCTGTGCAGATCAGCTTTTT
CAAGCAATATTATTATAGGTTTCTATTGTTTATTCCCTTACCTTCACGTTATCCATTGTAAAATTATTGGCAGAACCTTCTTGTTTACGC
CTCTGTAGTAGAAGCTTACTGAGGCCTTAACTATGAACTAGCTGTTCTGCCCTCCTACATCATGCGCAGCCGTACTTGTTAGTCATTCTG
AAATCAGTTGTTGGAGTTCAAGTTTCTAAGCTTTATACCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan