ESTScan Details for Unigene SGN-U618386

Score 
259
Direction 
Forward
Predicted Peptide Sequence 
RARLRXEAPENYVRGSDPRAVNTTDSKAGALAISTFWDTPIYDVPWVERLRYNIIQVYTAFLQLQSLPRLRSSQLALTSADSSFTCRLTT
PATSQCSDFRTPPILGEVIWCNRLGQWEKNTEKIRFKPMVKETEYYDVLGVSPAATEAEIKKAYYIKARQVHPDKNPNDPQAAQNFQVLG
EAYQVLSDPAQRQAYDNYGKSGISTEAIIDPAAIFAMLFGSELFEEYIGQLAMASMASLDIFTEGEDFDAKKLQEKMRVV
Predicted Coding Sequence 
AGGGCCCGCCTGCGTXCTGAAGCACCCGAGAACTATGTGAGGGGGTCCGACCCACGGGCAGTCAACACAACGGATTCAAAGGCAGGGGCG
CTTGCAATCTCCACCTTCTGGGATACTCCCATTTATGACGTGCCATGGGTTGAGAGATTGAGATATAACATCATCCAAGTTTATACCGCG
TTTCTGCAACTTCAGTCTCTTCCGCGTCTTCGATCAAGCCAGCTTGCTCTCACTTCAGCTGATAGTTCATTCACCTGCCGTTTGACGACG
CCAGCAACTTCTCAGTGTTCTGATTTCCGTACCCCACCCATCCTAGGAGAAGTGATTTGGTGTAATCGGCTAGGTCAATGGGAGAAGAAC
ACAGAAAAAATTCGCTTCAAGCCGATGGTGAAGGAGACGGAATACTACGACGTTTTGGGGGTTAGCCCAGCCGCAACTGAAGCTGAAATT
AAGAAAGCTTATTACATTAAGGCACGACAGGTTCATCCCGATAAAAATCCAAATGACCCTCAAGCAGCCCAAAATTTCCAGGTTTTGGGA
GAGGCTTACCAAGTGCTGAGTGATCCTGCCCAACGACAGGCTTACGATAATTATGGGAAATCAGGAATTTCAACTGAAGCTATAATTGAT
CCTGCAGCAATATTTGCCATGCTTTTCGGAAGTGAGCTTTTTGAAGAATACATTGGTCAGCTCGCCATGGCATCAATGGCTTCATTGGAT
ATTTTCACCGAAGGTGAAGATTTTGATGCTAAAAAGCTGCAAGAAAAAATGAGGGTTGTT
Edits in Original Sequence 
GGCGAATAATTTGAGTAAGAAAGGCACGCCCTTCTAGCATTTTTGCATTTTTTTTTTAATCATA(5')AGGGCCCGCCTGCGTXCTGAAG
CACCCGAGAACTATGTGAGGGGGTCCGACCCACGGGCAGTCAACACAACGGATTCAAAGGtCAGGGGCGCTTGCAATCTCCACCTTCTGG
GATACTCCCATTTATGACGTGCCATGGcGTTGAGAGATTGAGATATAACATCATCCAAGTTTATACCGCGTTTCTGCAACTTCAGTCTCT
TCCGCGTCTTCGATCAAGCCAGCTTaGCTCTCACTTCAGCTGATAGTTCATTCACCTGCCGTTTGACGACGCCAGCAACTTCTCAGTGTT
CTGATTTCCGTACCCCACCCATCCTAGGAGAAGTGATTTGGTGTAATCGGCTAGGTCAATcGGGAGAAGAACACAGAAAAAATTCGCTTC
AAGCCGATGGTGAAGGAGACGGAATACTACGACGTTTTGGGGGTTAGCCCAGCCGCAACTGAAGCTGAAATTAAGAAAGCTTATTACATT
AAGGCACGACAGGTTCATCCCGATAAAAATCCAAATGACCCTCAAGCAGCCCAAAATTTCCAGGTTTTGGGAGAGGCTTACCAAGTGCTG
AGTGATCCTGCCCAACGACAGGCTTACGATAATTATGGGAAATCAGGAATTTCAACTGAAGCTATAATTGATCCTGCAGCAATATTTGCC
ATGCTTTTCGGAAGTGAGCTTTTTGAAGAATACATTGGTCAGCTCGCCATGGCATCAATGGCTTCATTGGATATTTTCACCGAAGGTGAA
GATTTTGATGCTAAAAAGCTGCAAGAAAAAATGAGGGTTGTT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan