ESTScan Details for Unigene SGN-U618440

Score 
471
Direction 
Forward
Predicted Peptide Sequence 
XFFLINDNQVAIDLFAEAPPPRLPAFGAGVRGETYYFSIMSHNPTIPPSLSPPPTEFIPEPRRIQPVPTPTPSLYKQKSWSPDTYRDEAW
QRRKGNHDIRCNRRSKSVTEEDLEELKACIELGFSFDSPKMDQRLSDTFPAYGLFYAVNKNYNDTVSKHITLASPFSSTVSDCDTPSPLD
SPHNIFDPGENPQTVKTRLRQWAQVVACXRSSIFKVNDDDELDTDDEDDEQLVDEVFVVVQPKGFMIVEKVTKSNKFGEVMIVLLFMFHI
DDINYPTRPPTGLIARMLAGNLVMCRSTNXTGGASPNGKRILEFLEVLTLATVWVLAFHDW
Predicted Coding Sequence 
XGCTTCTTTTTAATTAACGATAACCAGGTAGCCATCGACCTCTTCGCCGAAGCCCCTCCTCCCCGTCTCCCCGCCTTTGGGGCTGGXGTG
AGAGGAGAGACGTATTATTTCTCCATCATGTCCCACAACCCCACCATTCCTCCATCACTCTCACCGCCCCCAACGGAGTTCATACCGGAG
CCCCGGCGGATTCAGCCAGTGCCCACACCTACTCCATCTCTGTACAAACAAAAATCCTGGTCTCCGGACACTTATCGTGATGAGGCTTGG
CAGCGGCGGAAGGGAAATCACGACATTCGCTGCAACCGTCGGAGTAAGAGCGTGACCGAGGAAGACCTTGAGGAACTCAAGGCTTGTATT
GAATTGGGTTTCAGTTTTGACTCCCCAAAAATGGACCAACGTTTGTCTGATACTTTTCCGGCCTATGGACTATTTTATGCTGTAAACAAG
AATTACAACGACACAGTTTCTAAGCATATCACTTTGGCATCGCCTTTCTCTTCCACTGTCTCGGACTGCGACACGCCTTCCCCTCTTGAC
AGCCCTCATAACATCTTTGATCCAGGTGAAAATCCACAAACGGTGAAGACAAGATTGAGACAGTGGGCACAAGTGGTTGCCTGTGXCCGT
TCGTCAATCTTCAAGGTGAATGATGACGATGAATTGGATACAGATGATGAAGATGATGAACAGCTTGTAGATGAAGTCTTTGTTGTTGTT
CAACCAAAGGGTTTCATGATAGTTGAAAAAGTAACCAAATCCAACAAATTTGGTGAAGTCATGATAGTTCTCCTATTCATGTTTCACATT
GATGACATAAATTATCCAACACGTCCACCGACTGGATTAATTGCTCGCATGCTTGCTGGTAATTTGGTTATGTGTAGGAGTACTAATXAT
ACCGGTGGTGCCTCACCTAATGGGAAAAGGATCTTGGAATTTCTTGAGGTGTTGACTTTAGCTACTGTTTGGGTGCTTGCTTTCCATGAT
TGG
Edits in Original Sequence 
(5')XGCTTCTTTTTAATTAACGATAACCAGGTAGCCATCGACCTCTTCGCCGAAGCCCCTCCTCCCCGTCTCCCCGCCTTTGGGGCTGG
XGTGAGAGGAGAGACGTATTATTTCTCCATCATGTCCCACAACCCCACCATTCCTCCATCACTCTCACCGCCCCCAACGGAGTTCATACC
GGAGCCCCGGCGGATTCAGCCAGTGCCCACACCTACTCCATCTCTGTACAAACAAAAATCCTGGTCTCCGGACACTTATCGTGATGAGGC
TTGGCAGCGGCGGAAGGGAAATCACGACATTCGCTGCAACCGTCGGAGTAAGAGCGTGACCGAGGAAGACCTTGAGGAACTCAAGGCTTG
TATTGAATTGGGTTTCAGTTTTGACTCCCCAAAAATGGACCAACGTTTGTCTGATACTTTTCCGGCCTATGGACTATTTTATGCTGTAAA
CAAGAATTACAACGACACAGTTTCTAAGCATATCACTTTGGCATCGCCTTTCTCTTCCACTGTCTCGGACTGCGACACGCCTTCCCCTCT
TGACAGCCCTCATAACATCTTTGATCCAGGTGAAAATCCACAAACGGTGAAGACAAGATTGAGACAGTGGGCACAAGTGGTTGCCTGTGX
CCGTTCGTCAATCTTCAAGGTGAATGATGACGATGAATTGGATACAGATGATGAAGATGATGAACAGCTTaGTAGATGAAGTCTTTGTTG
TTGTTCAACCAAAGGGTTTCATGATAGTTGAAAAAGTAACCAAAtTCCAACAAATTTGGTGAAGTCATGATAGTTCTCCTATTCATGTTT
CACATTGAtTGACATAAATTATCCAACACGTCCACCGACTGGATTAATTGCTCGCATGCTTGCtTGGTAATTTGGTTATGTGTAGGAGTA
CTAATXATACCGGTGGTGCCTCACCTAATGGGAAAAGGATCTTGGAATTTCTTGAGGTGTTGACTTTAGCTACTGTTTGGGTGCTTGCTT
TCCATGATTGG(3')TGTTGTTGAATCTGTATTACATTAATGCTTTGCTTCGGCTTTTTTGCATCTGCTTTACCTTTTCCCACTTGGGTT
GAGGTACTAGATTTCATTTTGATGTCTGTCCCATGATGAATGATGTGGGAAAAGATGATGCCCGTTCCTTTGTTTGATTGAACATACACA
TCCTTTGTTTTGTTGAAGTCTGCCGCCACCACCCCCCCCCCCTTTTTTTTTTTTGGGTAAAACGTACCTGCTAGCTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan