ESTScan Details for Unigene SGN-U618544

Score 
618
Direction 
Forward
Predicted Peptide Sequence 
XFDTKYLIHFDNFMAEKDGQLNSNHDLIQTMELPMVDVSILTQDSNEKSIVIKQIQEACQTWGAFQVINHGVSESVIQAAMEVNRNFFDL
PEMMKKEILELGSRDMFSPVKLLTFQRSDLLQRELVRLYANPFEDFIDFWPTDPADYREKMGRYTKDVRKLGITLFGAIMESLNLGPTHL
QENFDKGMHMVIANSYSPPTPESSIKLGAAPHSDHGIIIILRQSSPGLEVLDMADGKWKALPCSEGSPSVLVGXPSGAIKQWDIPKRFSP
X
Predicted Coding Sequence 
XGCTTCGATACGAAATATCTGATACATTTTGATAATTTCATGGCTGAAAAAGATGGTCAGCTCAACAGTAATCATGACCTGATCCAAACC
ATGGAACTGCCTATGGTTGACGTTTCCATCCTTACCCAAGATTCTAACGAGAAGTCTATAGTCATCAAGCAGATTCAAGAAGCTTGCCAA
ACTTGGGGCGCTTTTCAGGTTATTAATCATGGGGTATCCGAATCAGTCATACAAGCCGCCATGGAAGTGAACAGAAACTTCTTTGACTTG
CCGGAGATGATGAAAAAGGAGATATTGGAGCTTGGTTCCAGGGACATGTTCAGCCCAGTAAAACTGCTTACTTTTCAACGCAGTGACCTG
CTCCAAAGGGAATTAGTGAGGCTTTATGCCAATCCTTTTGAAGACTTCATTGATTTCTGGCCCACCGATCCTGCTGATTACAGGGAGAAA
ATGGGAAGGTACACTAAGGACGTGAGAAAATTGGGCATCACATTGTTTGGAGCCATCATGGAAAGCTTGAACTTGGGTCCAACACACCTT
CAAGAAAATTTCGATAAAGGAATGCACATGGTTATAGCAAACAGTTACTCACCACCAACTCCAGAATCAAGCATCAAGCTAGGTGCAGCT
CCTCATTCCGATCATGGCATCATCATCATTCTCCGGCAAAGCTCACCGGGTCTTGAGGTCCTGGACATGGCTGATGGCAAATGGAAAGCT
CTTCCTTGCTCAGAAGGGTCCCCTTCAGTCCTTGTTGGAGXACCATCTGGAGCTATTAAGCAATGGGATATTCCAAAGCGTTTTTCACCG
GXX
Edits in Original Sequence 
(5')XGCTTCGATACGAAATATCTGATACATTTTGATAATcTTCATGGCTGAAAAAGATGGTCAGCTCAACAGTAATCATGACCTGATCC
AAACCATGGAACTGCCTATGGTTGACGTTTCCATCCTTACCCAAGATTCTAACGAGAAGTCTATAGTCATCAAGCAGATTCAAGAAGCTT
GCCAAACTTGGGGCGCTTTTCAGGTTATTAATCATGGGGTATCCGAATCAGTCATACAAGCCGCCATGGAAGTGAACAGAAACTTCTTTG
ACTTGCCGGAGATGATGAAAAAGGAGATATTGGAGCTTGGTTCCAGGGACATGTTCAGCCCAGTAAAACTGCTTACTTTTCAACGCAGTG
ACCTGCTCCAAAGGGAATTAGTGAGGCTTTATGCCAATCCTTTTGAAGACTTCATTGATTTCTGGCCCACCGATCCTGCTGATTACAGGG
AGAAAATGGGAAGGTACACTAAGGACGTGAGAAAATTGGGCATCACATTGTTTGGAGCCATCATGGAAAGCTTGAACTTGGGTCCAACAC
ACCTTCAAGAAAATTTCGATAAAGGAATGCACATGGTTATAGCAAACAGTTACTCACCACCAACTCCAGAATCAAGCATCAAGCTAGGTG
CAGCTCCTCATTCCGATCATGGCATCATCATCATTCTCCGGCAAAGCTCACCGGGTCTTGAGGTCCTGGACATGGCTGATGGCAAATGGA
AAGCTCTTCCTTGCTCAGAAGGGTCCCCTTCAGTCCTTGTTGGAGXACCATCTGGAGCTATTAAGCAATGGGATATTCCAAAGCGTTTTT
CACCGGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan