ESTScan Details for Unigene SGN-U618787

Score 
467
Direction 
Forward
Predicted Peptide Sequence 
XKGHEGAVLAARFNSHGEYCLSCGKDRPYASGIPTXGIHIKTYKSHGREVRDVHVTPDNSKLCSCGGDRQVFYWDVASGRVIRKFRGHDS
EVNAVKFNEYATVVVSAGNDHSLRAWDCRSHSTEPIQIIDTFRDTVMSVCLTKTEIIAGSVDGTVRTFDIRIGREISDDLGQPVNCISLS
NDSNCILASCLDSTLRLWDRSTGELLQEYKGHTCKSFKMDCCLTNSDAHVTGGSEDGFIYFWDLVDASAISSFRAHSSVVTSVSYHPTDS
CMVTSSVDGTXPGVENLRQDIFSIFPFFFSMILGLAHQSYSGLL*
Predicted Coding Sequence 
XGGAAAGGACACGAGGGTGCCGTCTTAGCAGCAAGATTCAACTCGCACGGCGAGTATTGTCTGAGCTGCGGCAAGGACCGTCCATACGCC
TCTGGAATCCCCACCGXTGGAATTCACATCAAAACCTACAAATCCCATGGCCGTGAAGTCCGGGATGTCCATGTCACCCCGGACAATTCC
AAGCTTTGTTCTTGTGGTGGTGATCGACAAGTCTTCTATTGGGATGTAGCAAGTGGTCGAGTAATTCGAAAATTCCGTGGCCATGACAGT
GAGGTGAATGCTGTTAAGTTTAATGAGTATGCAACTGTAGTAGTATCAGCAGGAAATGATCACTCTTTGCGTGCTTGGGACTGCAGGTCT
CATAGTACTGAGCCTATACAGATCATTGATACTTTTCGGGATACTGTCATGTCTGTTTGTTTAACAAAAACTGAGATAATTGCTGGAAGT
GTTGATGGAACTGTTCGGACATTTGATATTCGAATTGGTAGAGAAATTTCTGATGACTTGGGCCAACCTGTCAACTGTATCTCTCTGTCA
AATGACAGTAATTGTATCTTAGCAAGCTGCCTGGATTCAACTCTACGACTATGGGACAGATCTACTGGTGAACTTTTGCAAGAATATAAA
GGTCATACTTGCAAGTCATTTAAGATGGACTGCTGCCTCACAAATAGTGATGCGCATGTGACTGGGGGTTCTGAAGATGGCTTTATCTAC
TTCTGGGATTTGGTGGATGCATCTGCCATATCAAGCTTCCGAGCTCACTCCTCAGTGGTGACTAGCGTCAGCTATCACCCAACAGATAGC
TGTATGGTGACTTCATCTGTTGATGGAACTAXTCCGGGTGTGGAAAACCTAAGACAAGATATCTTCTCCATATTTCCTTTCTTTTTCTCC
ATGATTCTTGGTCTTGCTCATCAGAGTTACTCAGGCCTCCTGTAA
Edits in Original Sequence 
(5')XGGAAAGGACACGAGGGTGCCGTCTTAGCAGCAAGATTCAACTCGCACGGCGAGTATTGTCTGAGCTGCGGCAAGGACCGTaCCAT
ACGCCTCTGGAATCCCCACCGXTGGAATTCACATCAAAACCTACAAATCCCATGGCCGTGAAGTCCGGGATGTCCATGTCACCCCGGACA
ATTCCAAGCTTTGTTCTTGTGGTGGTGATCGACAAGTCTTCTATTGGGATGTAGCAAGTGGTCGAGTAATTCGAAAATTCCGTGGCCATG
ACAGTGAGGTGAATGCTGTTAAGTTTAATGAGTATGCAACTGTAGTAGTATCAGCAGGAAATGATCACTCTTTGCGTGCTTGGGACTGCA
GGTCTCATAGTACTGAGCCTATACAGATCATTGATACTTTTCGGGATACTGTCATGTCTGTTTGTTTAACAAAAACTGAGATAATTGCTG
GAAGTGTTGATGGAACTGTTCGGACATTTGATATTCGAATTGGTAGAGAAATTTCTGATGACTTGGGCCAACCTGTCAACTGTATCTCTC
TGTCAAATGACAGTAATTGTATCTTAGCAAGCTGCCTGGATTCAACTCTACGACTATGGGACAGATCTACTGGTGAACTTTTGCAAGAAT
ATAAAGGTCATACTTGCAAGTCATTTAAGATGGACTGCTGCCTCACAAATAGTGATGCGCATGTGACTGGGGGTTCTGAAGATGGCTTTA
TCTACTTCTGGGATTTGGTGGATGCATCTGCCATATCAAGCTTCCGAGCTCACTCCTCAGTGGTGACTAGCGTCAGCTATCACCCAACAG
ATAGCTGTATGGTGACTTCATCTGTTGATGGAACTAXTCCGGGTGTGGAAAACCTAAGACAAGATATCTTCTCCATATTTCCTTTCTTTT
TCTCCATGATTCTTGGTCTTGCTCATCAGAGTTACTCAGGCCTCCTGTAA(3')AGACACATTATGTACGATGTGGTATAGAGCAAGAGA
AGTGAACCAGTTAATAGTAATGCTTTGTAATTTATTATCCTCCGTTATCCCCTCTTGTAATTATTTGTATGGACGTGAGAATTACCTGTT
TTATTAAGGCTGAGGTACTTTGACGTCTATAGGAATGTTGTCTGTGCGGTAGAAACATCTTCTCTGGACTTGCCAGATGACACCAGCTTC
TTTTGGCATTTCTATTACTCAATGTTGATTTGGT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan