ESTScan Details for Unigene SGN-U619007

Score 
233
Direction 
Forward
Predicted Peptide Sequence 
XRKPFKDSLKVLEADIQHANTLASDFPREYDGALPADENVLQSSSTPVPFPGSVADCHLAGALGLLRILIYKVYVDGTTTMSTHERKASI
REFYAXYLSLINATPEGGNRFRRQKAKSSXAWKDIKEEMKRNTGKFXELEVEREEECGICMEMNSKIVLPNCNHAMCMKCYREWRLRSQS
CPFCRDSLKRVNSGDLWVLMDSKDVVDMATITRENLRRLFMYIDKLPLVVPDNLFDTYNNXFKVGKRVLSERSPEXAAVSLGVLNPI
Predicted Coding Sequence 
XGGCGGAAGCCCTTTAAGGATTCTCTCAAAGTTCTTGAAGCTGATATTCAGCATGCCAATACTCTGGCTTCGGATTTTCCACGGGAGTAT
GATGGTGCXTTGCCTGCAGATGAGAATGTCCTACAGTCCAGCAGCACACCTGTTCCTTTTCCTGGTTCAGTGGCTGACTGTCACCTAGCT
GGTGCTCTTGGCCTGTTAAGAATCTTGATTTATAAGGTTTACGTCGATGGCACCACAACAATGTCCACTCATGAAAGGAAAGCAAGCATT
AGAGAATTCTATGCTXATTATCTATCCCTCATTAATGCAACTCCAGAGGGGGGTAACCGATTCAGAAGACAAAAAGCAAAAAGCAGTGXT
GCTTGGAAAGATATAAAAGAAGAGATGAAGAGGAACACCGGCAAATTTXCGGAGCTAGAAGTTGAAAGGGAGGAAGAATGTGGTATTTGC
ATGGAGATGAACAGCAAAATAGTCTTGCCCAACTGCAACCATGCCATGTGCATGAAATGCTACCGTGAATGGCGTTTAAGGTCACAATCG
TGCCCCTTCTGCCGTGATAGCCTGAAGAGGGTCAACTCAGGTGATCTCTGGGTGCTTATGGACAGCAAGGATGTCGTGGACATGGCTACC
ATAACAAGGGAGAATCTGAGAAGGCTCTTTATGTATATAGATAAGTTGCCTCTTGTTGTTCCGGATAACCTTTTTGACACTTACAATAAT
XCATTTAAGGTAGGCAAAAGGGTTTTGTCTGAGCGGTCTCCTGAAGXTGCTGCTGTGTCTCTGGGTGTTCTAAACCCTATA
Edits in Original Sequence 
(5')XGGCGGAAGCCCTTTAAGGATTCTCTCAAAGTTCTTGAAGCTGATATTCAGCATGCCAATACTCTGGCTTCGGATTTTCCACGGGA
GTATGATGGTGCXTTGCCTGCAGATGAGAATGTCCTACAGTCCAGCAGCACACCTGTTCCTTTTCCTGGTTCAGTGGaCTGACTGTCACC
TAGCTGGTGCTCTTGGCCTGTTAAGAATCTTGATTTATAAGGTTTACGTCGATGGCACCACAACAATGTCCACTCATGAAAGGAAAGCAA
GCATTAGAGAATTCTATGCTXATTATCTATCCCTCATTAATGCAACTCCAGAGGGGGGTAACCGATTCAGAAGACAAAAAGCAAAAAGCA
GTGXTGCTTGGAAAGATATAAAAGAAGAGATGAAGAGGAACACCGGCAAATTTXCGGAGCTAGAAGTTGAAAGGGAGGAAGAATGTGGTA
TTTGCATGGAGATGAACAGCAAAATAGTCTTGCCCAACTGCAACCATGCCATGTGCATGAAATGCTACCGTGAATGGCGTTTAAGGTCAC
AATCGTGCCCCTTCTGCCGTGATAGCCTGAAGAGGGTCAACTCAGGTGATCTCTGGGTGCTTATGGACAGCAAGGATGTCGTGGACATGG
CTACCATAACAAGGGAGAATCTGAGAAGGCTCTTTATGTATATAGATAAGTTGCCTCTTGTTGTTCCGGATAACCTTTTTGACACTTACA
ATAATXCATTTAAGGTAGGCAAAAGGGTTTTGTCTGAGCGGTCTCCTGAAGXTGCTGCTGTGTCTCTGGGTGTTCTAAACCCTATA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan