ESTScan Details for Unigene SGN-U619181

Score 
196
Direction 
Forward
Predicted Peptide Sequence 
MAEKVTVMRLNVDLQCPSCYKKVKKILCKFPETKYMMEAQSGDHHRGVLYPEKIRDKLCCKGDKVIKSIEIVELPPPPKPKPPEKPKEPE
KPKEPEKPKEPAKLKETDKPKEPANPPVVVVVVEKPKIPEKPPFEPVPIIPPPPPPAPVPVEPACTRQFQWGSVVSHVRKGTAGDHATTG
RAARAPATLYDSYGYKYGSGMGRGTRTAAAIISVRRTLEAVRLCERSKEFGGGDLX
Predicted Coding Sequence 
ATGGCTGAGAAGGTCACAGTAATGAGACTCAATGTTGATCTTCAATGCCCCAGCTGCTACAAGAAGGTCAAGAAAATCCTCTGCAAATTC
CCAGAGACCAAGTATATGATGGAAGCACAATCTGGTGACCATCACCGTGGTGTGCTGTACCCGGAAAAAATCCGCGACAAATTATGTTGC
AAGGGTGACAAAGTCATTAAGAGCATTGAGATCGTGGAGCTACCCCCACCACCAAAGCCCAAGCCACCCGAGAAACCCAAGGAGCCCGAG
AAGCCGAAAGAGCCAGAGAAGCCTAAGGAGCCCGCGAAGCTCAAAGAGACAGATAAACCTAAAGAGCCTGCGAACCCCCCAGTGGTTGTG
GTTGTGGTTGAAAAACCAAAAATTCCCGAAAAACCCCCATTTGAACCGGTCCCGATAATCCCACCACCGCCACCACCAGCACCGGTTCCA
GTTGAACCTGCTTGCACCCGCCAGTTCCAGTGGGGGTCTGTTGTGTCCCATGTTCGGAAGGGTACGGCGGGGGACCATGCTACTACTGGT
AGGGCAGCCCGTGCCCCCGCTACCCTTTATGATAGCTATGGTTACAAGTACGGGTCGGGTATGGGAAGGGGTACCCGTACAGCCGCTGCA
ATTATTTCAGTGAGGAGAACGCTGGAGGCTGTACGATTATGTGAGAGGAGTAAAGAATTTGGTGGXGGTGACCTTAXX
Edits in Original Sequence 
GCCCCTACATCGCCACTGACTGCCTCCCTCATCAACC(5')ATGGCTGAGAAGGTCACAGTAATGAGACTCAATGTTGATCTTCAATGCC
CCAGCTGCTACAAGAAGGTCAAGAAAATCCTCTGCAAATTCCCAGAGACCAAGTATATGATGaGAAGCACAATCTGGTGACCATCACCGT
GGTGTGCTGTAgCCCGGAAAAAATCCGCGACAAATTATGTTGCAAGGGTGACAAAGTCATTAAGAGCATTGAGATCGTGGAGCTACCCCC
ACCACCAAAGCCCAAGCCACCCGAGAAACCCAAGGAGCCCGAGAAGCCGAAAGAGCCAGAGAAGCCTAAGGAGCCCGCGAAGCTCAAAGA
GACAGATAAACCTAAAGAGCCTGCGAACCCCCCAGTGGTTGTGGTTGTGGTTGAAAAACCAAAAATTCCCGAAAAACCCCCATTTGAACC
GGTCCCGATAATCCCACCACCGCCACCACCAGCACCGGTTCCAGTTGAACCgTGCTTGCACCCGCCAGTTCCAGTGGGGGTCTGTTGTGT
CCCATGTTCGGAAGGGTACGGCGGGGGACCATGCTACTACTGGTAcGGGCAGCCCGTGCCCCCGCTACCCTaTTATGATAGCTATGGTTA
CAAGTACGGGTaCGGGTATGGGAAGGGGTACCCGTACAGCCGCTGCAATTATTTCAGTGAGGAGAACGCTGGAGGCTGTACGATTATGTG
AGAGGAGTAAAGAATTTGGTGGXGGTGACCTTAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan