ESTScan Details for Unigene SGN-U619598

Score 
908
Direction 
Forward
Predicted Peptide Sequence 
XWTFSAFPLSLISIHLFLCFFVSGSKNNLGLAEWELRVIFIQENGDXKSELWLKNFHGNFLTHFSRPYLLSMEVPGEDEVKKAEDRMTSA
AAFVEGGIQEACDDSAAYALKPSAESDPSTVTFASMSFTFNVFLNGVKEVRIXPMCWQTISLKDPASQQLLDAVEREKRIRFTPARNATI
FHHPTLGDFELQHLPVGVNDSELEERIIQHLAAAAAMGRARHIARREGSRGHSSAQGRPHFLVFSTHASAPGPGAGPASASVGAEPEADA
TAPVNDPSSLTEQSAVNHCNAPPNLTSVPSGQLSASSSGSVAMLNNPRDLSTDNRSVARQAPSGQDRAGTSDFQSFSDSWRSRFSAMSMK
YKESLSKSTRGWKERLFARSNSMADIRSEVRREVNAGIASVSRMMERLETRENSRPGPVSTSNNPPVTEQNNPGNLDESPLSDISALPAN
SXLALSGIHCLAVASFLSIAALEVIKTRPPNGNADRGCLYGQGRMLKTTITDXMMPIRXKKEPEAEQRFLR*
Predicted Coding Sequence 
XGTTGGACCTTTTCGGCTTTTCCTCTTTCTCTAATCTCTATCCATCTCTTTCTTTGTTTCTTTGTCTCTGGGTCCAAGAATAATTTGGGC
TTAGCTGAATGGGAACTTAGAGTTATCTTCATCCAGGAAAATGGGGATAAXAAATCAGAGCTTTGGCTTAAAAATTTCCATGGAAATTTC
TTGACCCATTTTTCTAGGCCATATCTTCTTTCAATGGAGGTTCCGGGGGAGGATGAGGTTAAAAAGGCAGAGGATCGTATGACATCAGCC
GCGGCTTTTGTTGAAGGAGGTATACAGGAGGCATGTGATGATTCTGCAGCATATGCCTTGAAGCCTTCTGCXGAAAGTGATCCATCCACG
GTAACATTTGCAAGCATGAGTTTCACCTTCAATGTATTCTTGAATGGTGTCAAAGAAGTTCGAATTGXTCCAATGTGCTGGCAAACTATA
AGTTTGAAAGATCCTGCTAGTCAACAATTGCTTGATGCTGTAGAAAGAGAGAAACGTATTAGGTTCACTCCAGCAAGAAATGCCACGATA
TTTCATCATCCCACTCTGGGGGATTTTGAACTGCAACACTTGCCTGTTGGAGTTAATGATTCTGAACTGGAAGAACGCATTATTCAGCAC
TTGGCTGCTGCTGCTGCAATGGGAAGGGCACGTCATATTGCTCGTAGAGAGGGCTCAAGGGGTCACTCATCTGCTCAGGGTCGTCCACAT
TTTCTGGTGTTTTCCACACATGCCAGTGCCCCAGGTCCAGGCGCTGGTCCTGCTTCAGCTTCTGTAGGAGCGGAACCTGAGGCAGATGCA
ACAGCCCCTGTTAATGATCCTTCTTCACTCACCGAGCAATCAGCAGTGAATCATTGCAATGCACCXCCAAATCTTACTAGTGTTCCTAGT
GGTCAACTCTCTGCTTCGTCATCTGGATCAGTTGCCATGCTTAACAACCCTCGAGATCTCTCCACTGACAATAGAAGCGTGGCTCGTCAG
GCACCATCAGGTCAAGATAGAGCAGGAACATCAGATTTCCAGTCTTTTTCAGATTCCTGGAGATCTCGTTTTAGTGCAATGTCAATGAAA
TACAAAGAATCTCTTTCAAAGAGCACAAGAGGATGGAAAGAAAGGCTTTTTGCACGAAGTAATTCCATGGCAGATATTCGCTCAGAAGTT
AGGAGAGAAGTGAATGCTGGAATTGCTAGTGTTTCCCGCATGATGGAACGCCTAGAAACAAGAGAAAACAGTAGACCTGGTCCTGTTTCA
ACGTCAAATAATCCTCCAGTGACTGAGCAAAATAACCCTGGGAATTTGGATGAATCACCGTTGAGTGACATTTCGGCTCTTCCTGCAAAT
TCTGXTCTCGCGTTAAGTGGTATACATTGTTTAGCTGTTGCATCTTTCCTCAGCATTGCAGCTTTGGAGGTTATTAAAACTCGTCCTCCA
AATGGAAATGCTGATAGAGGATGCTTATATGGGCAGGGCAGAATGTTGAAAACAACCATTACTGATAXGATGATGCCAATTAGGGAXAAG
AAAGAGCCTGAAGCGGAACAACGATTTCTGCGTTAA
Edits in Original Sequence 
(5')XGTTGGACCTTTTCGGCTTTTCCTCTTTCTCTAATCTCTATCCATCTCTTTCTTTGTTTCTTTGTCTCTGGGTCCAAGAATAATTT
GGGCTTAGCTGAATGGGAACTTAGAGTTATCTTCATCCAGGAAAATaGGGGATAAXAAATCAGAGCTTTGGCTTAAAAATTTCCATGGAA
ATTTCTTGACCCATTTTTCTAGGCCATATCTTCTTTCAATGGAGGTTCCGGGGGAGGATGAGGTTAAAAAGGCAGAGGATCGTATGACAT
CAGCCGCGGCTTTTGTTGAAGGAGGTATACAGGAGGCATGTGATGATTCaTGCAGCATATGCCTTGAAGCCTTCTGCXGAAAGTGATCCA
TCCACGGTAACtATTTGCAAGCATGAGTTTCACCTTCAATGTATTCTTGAATGGTGTCAAAGAAGTTCGAATTGXTCCAATGTGCTGGCA
AACTATAAGTTTGAAAGATCCTGCTAGTCAACAATTGCTTGATGCTGTAGAAAGAGAGAAACGTATTAGGTTCACTCCAGCAAGAAATGC
CACGATATTTCATCATCCCACTCTGGGGGATTTTGAACTGCAACACTTGCCTGTTGGAGTTAATGATTCTGAACTGGAAGAACGCATTAT
TCAGCACTTGGCTGCTGCTGCTGCAATGGGAAGGGCACGTCATATTGCTCGTAGAGAGGGCTCAAGGGGTCACTCATCTGCTCAGGGTCG
TCCACATTTTCTGGTGTTTTCCACACATGCCAGTGCCCCAGGTCCAGGCGCTGGTCCTGCTTCAGCTTCTGTAGGAGCGGAACCTGAGGC
AGATGCAACAGCCCCTGTTAATGATCCTTCTgTCACTCACCGAGCAATCAGCAGTGAATCATTGCAATGCACCXCCAAATCTTACTAGTG
TTCCTAGTGGTCAACTCTCTGCTTCGTCATCTGGATCAGTTGCCATGCTTAACAACCCTCGAGATCTCTCCACTGACAATAGAAGCGTGG
CTCGTCAGGCACCATCAGGTCAAGATAGAGCAGGAACATCAGATTTCCAGTCTTTTTCAGATTCCTGGAGATCTCGTTTTAGTGCAATGT
CAATGAAATACAAAGAATCTCTTTCAAAGAGCACAAGAGGATGGAAAGAAAGGCTTTTTGCACGAAGTAATTCCATGGCAGATATTCGCT
CAGAAGTTAGGAGAGAAGTGAATGCTGGAATTGCTAGTGTTTCCCGCATGATGGAACGCCTAGAAACAAGAGAAAACAGTAGACCTGGTC
CTGTTTCAACGTCAAATAATCCTCCAGTGACTGAGCAAAATAACCCTGGGAATTTGGATGAATCACCGTTGAGTGACATTTCGGCTCTTC
CTGCAAATTCTGXTCTCGCGTTAAGTGGTATACATTGTTTaAGCTGTTGCATCTTTCCTCAGCATTGCAGCTTTGGAGGTTATTAAAACT
CGTCCTCCAAATGtGAAATGCTGATAGAGGATGCTTATATGGGCAGGGCAGAATGTTGAAAACAACCATTACTGATAXGATGATGCCAAT
TAGGGAXAAGAAAGAGCCTGAAGCGGAACAACGATTTCTGCGTTAA(3')AAAGCTGTAAATTTGTTTATGCAAACTTGGGTTTGTTATG
TATTGCACTCCAATGCTTGTAATAGCTGTTGGACTGAAGTGGCAGTCTTCTATACCCTTCTGCTTGAGAACTAATTTTTCTCTAATTCTA
AGGCTGAAGGCTAATGAGCCCCAGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan