ESTScan Details for Unigene SGN-U619718

Score 
1855
Direction 
Forward
Predicted Peptide Sequence 
XLTLSKASSPKSSQNHQKPIFDRLIDWFDRENMDAAKLEELEKFIDQCKANPSILSDPSLSFFRDYIESLGGKLPPSAYKAGEYKAKSHV
AEDLDEDMDDVEDEDHSKVGADEEEEPEIIESDVELDDTEVVEPDNDPPQQMGDPSVEVSEESRDASQEAKAQAMEAISEGKLEDAIEQL
TKAISLNPTSAIMYATRATVYIKMKKPNAAVRDANAALEINPDSAKGYKSRGIARAMLGQWEEAAKDLHVASKLDYDEEISAVLKKVEPN
AHKIEEHRRKYERLRKERQDRKIERERQRRKAEAQAAYEKAKKQEKSSSSGRPGGMPGGFPGGMPGGFPGGSMPGGFPGGMPGGFPGGMP
GGMPGNVDYSKILNDPELMSAFKDPEVMAALQDVMKNPANLAQHQNNPKVAPIIAKMMSKFAGTKVDSWTSVLSGFPXLGHPGRHAVSKL
KAVCIFAFHVLQYVFTAAGVEVFILYTIYVGKFKFLNLPNEDXSIDGNAAQAFLX
Predicted Coding Sequence 
XGTCTCACTCTAAGCAAAGCAAGTTCCCCCAAATCATCACAAAATCATCAAAAACCCATTTTTGACCGATTGATTGATTGGTTTGATAGA
GAAAACATGGACGCGGCGAAGTTGGAAGAATTGGAGAAATTCATAGATCAATGCAAAGCAAACCCTTCCATTCTCTCCGACCCCTCCCTC
TCCTTTTTCCGCGACTACATCGAAAGCCTTGGGGGAAAGCTTCCACCATCTGCTTACAAGGCTGGAGAGTATAAGGCGAAGTCTCATGTG
GCCGAGGATCTTGATGAGGATATGGATGATGTTGAGGATGAGGATCACTCAAAGGTGGGTGCTGATGAAGAAGAGGAGCCTGAGATAATC
GAATCTGATGTTGAGCTTGATGACACTGAAGTTGTGGAGCCTGATAATGATCCTCCGCAACAGATGGGAGACCCTTCGGTTGAGGTTAGT
GAAGAAAGTCGTGATGCTTCTCAAGAGGCAAAGGCTCAGGCAATGGAGGCAATTTCTGAAGGAAAGCTGGAGGATGCAATTGAGCAGCTT
ACAAAAGCAATCTCACTCAATCCTACATCCGCAATCATGTATGCTACCAGAGCTACCGTGTATATCAAAATGAAGAAACCAAATGCTGCA
GTCAGAGATGCCAATGCAGCTCTGGAGATTAACCCTGATTCTGCTAAAGGGTACAAATCCCGTGGCATCGCACGAGCAATGCTTGGCCAG
TGGGAGGAGGCTGCCAAGGATCTTCACGTAGCTTCTAAGCTGGATTACGATGAAGAGATCAGTGCTGTACTGAAGAAGGTTGAGCCTAAT
GCTCACAAGATTGAGGAGCACCGTAGGAAATATGAAAGGCTTCGCAAAGAAAGGCAAGATAGAAAGATAGAACGAGAGAGACAGCGTCGC
AAGGCTGAAGCTCAGGCTGCTTATGAAAAGGCTAAGAAGCAAGAGAAGTCATCATCAAGTGGAAGACCTGGAGGCATGCCAGGTGGGTTC
CCAGGTGGGATGCCTGGTGGTTTCCCTGGAGGCAGCATGCCTGGTGGTTTCCCTGGAGGCATGCCTGGTGGTTTTCCTGGGGGCATGCCT
GGAGGGATGCCTGGGAATGTTGACTACAGCAAGATATTGAATGATCCTGAACTAATGTCAGCATTCAAAGATCCAGAAGTCATGGCTGCT
CTCCAAGATGTGATGAAGAATCCTGCCAATTTGGCCCAGCATCAAAATAATCCAAAGGTAGCTCCCATCATTGCAAAAATGATGAGTAAA
TTTGCXGGGACCAAAGTAGATTCCTGGACTAGTGTATTATCTGGTTTTCCAXCACTCGGACATCCAGGGCGTCACGCGGTATCCAAGCTG
AAAGCAGTGTGCATCTTTGCTTTCCATGTATTGCAATATGTCTTTACTGCAGCAGGAGTTGAGGTTTTCATTTTATACACTATTTATGTT
GGAAAGTTTAAATTTTTAAATCTCCCAAATGAAGATXTATCGATTGATGGGAATGCTGCTCAGGCTTTTTTGAGX
Edits in Original Sequence 
(5')XGTCTCACTCTAAGCAAAGCAAGTTCCCCCAAATCATCACAAAATCATCAAAAACCCATTTTTGACCGATTGATTGATTGGTTTGA
TAGAGAAAACATGGACGCGGCGAAGTTGGAAGAATTGGAGAAATTCATAGATCAATGCAAAGCAAACCCTTCCATTCTCTCCGACCCCTC
CCTCTCCTTTTTCCGCGACTACATCGAAAGCCTTGGGGGAAAGCTTCCACCATCTGCTTACAAGGCTGGAGAGTATAAGGCGAAGTCTCA
TGTGGCCGAGGATCTTGATGAGGATATGGATGATGTTGAGGATGAGGATCACTCAAAGGTGGGTGCTGATGAAGAAGAGGAGCCTGAGAT
AATCGAATCTGATGTTGAGCTTGATGACACTGAAGTTGTGGAGCCTGATAATGATCCTCCGCAACAGATGGGAGACCCTTCGGTTGAGGT
TAGTGAAGAAAGTCGTGATGCTTCTCAAGAGGCAAAGGCTCAGGCAATGGAGGCAATTTCTGAAGGAAAGCTGGAGGATGCAATTGAGCA
GCTTACAAAAGCAATCTCACTCAATCCTACATCCGCAATCATGTATGCTACCAGAGCTACCGTGTATATCAAAATGAAGAAACCAAATGC
TGCAGTCAGAGATGCCAATGCAGCTCTGGAGATTAACCCTGATTCTGCTAAAGGGTACAAATCCCGTGGCATCGCACGAGCAATGCTTGG
CCAGTGGGAGGAGGCTGCCAAGGATCTTCACGTAGCTTCTAAGCTGGATTACGATGAAGAGATCAGTGCTGTACTGAAGAAGGTTGAGCC
TAATGCTCACAAGATTGAGGAGCACCGTAGGAAATATGAAAGGCTTCGCAAAGAAAGGCAAGATAGAAAGATAGAACGAGAGAGACAGCG
TCGCAAGGCTGAAGCTCAGGCTGCTTATGAAAAGGCTAAGAAGCAAGAGAAGTCATCATCAAGTGGAAGACCTGGAGGCATGCCAGGTGG
GTTCCCAGGTGGGATGCCTGGTGGTTTCCCTGGAGGCAGCATGCCTGGTGGTTTCCCTGGAGGCATGCCTGGTGGTTTTCCTGGGGGCAT
GCCTGGAGGGATGCCTGGGAATGTTGACTACAGCAAGATATTGAATGATCCTGAACTAATGTCAGCATTCAAAGATCCAGAAGTCATGGC
TGCTCTCCAAGATGTGATGAAGAATCCTGCCAATTTGGCCCAGCATCAAAATAATCCAAAGGTAGCTCCCATCATTGCAAAAATGATGAG
TAAATTTGCXGGGACCAAAGTAGATTCCTGGACTAGTGTATTATCTGGTTTTCCAXCACTCGGACATCCAGGGCGTCACGCGGTATCCAA
GCTGAAAGtCAGTGTGCATCTTTGCTTTCCATGTATTGCAATATGTCTTTACTGCAGCAGGAGTTGAGGTTTTCATTTTATACACTATTT
ATGTTGGAAAGTTTAAATTTTTAAATCTCCCAtAATGAAGATXTATCGATTGATGGGAATGCTGCTCAGGCTTTTTTGAGX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan