Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U619866

Score 
688
Direction 
Forward
Predicted Peptide Sequence 
XNGDWHPLKTPPDRKPQTNPTNHHNSLSSPHSFPSVRPSIPTPFISIPLSSTHSTYYIDTALIIGSTARSPLAPSCIDXDLSSAGGXREK
SNVIEPHLAAVFYFVDFVHNGIAGLTSSFIRSEWPSTDIPLDNEAFALPKGYNAPQQVHITQGDYDGKAVIISWVTPDEPGSGQVRYGIS
EGKYDFTAKGTVKNYTFHNYKSGYIHKCLVDGLEYDTKYYYEIGDHDSARKFWFQTPPRIDPDASYKFGIIGDLGQTYNSLSTLEHYKRS
GGQTVLFVGDLSYADRYQYHDVGVRWDTWGRFIEQSAAYQPWIWCAGNHEIEYMPYMGEVTPFKSYLHRYPTPYPASKSSDPLWYAIRRG
SAHVIVLSSYSPFVKYTPQWRWLAEELKRVDRKKTPWLIVLMHVPIYNSNEAHFMEGESMRTVFESWFVKYKVDVVFAGHVHAYERSYRI
SNIHYNVSSGYPYPVPENQLPVNITVGDGGNQEX
Predicted Coding Sequence 
XXGAATGGTGACTGGCACCCCTTAAAGACTCCTCCCGACAGAAAACCACAAACGAACCCAACCAACCACCATAACTCACTGAGTTCTCCC
CACTCATTTCCGTCCGTCCGTCCGTCCATCCCAACGCCGTTCATCAGCATACCATTATCAAGCACACACAGTACATACTATATAGATACA
GCTCTGATTATCGGATCAACTGCTCGTTCCCCTCTTGCACCTTCTTGTATTGATXTTGATTTGAGTAGTGCAGGAGGAXTAAGGGAGAAA
TCAAATGTTATCGAACCGCATTTGGCTGCTGTTTTCTATTTTGTTGATTTCGTACACAATGGGATTGCGGGTTTAACCAGTAGCTTTATT
CGTTCCGAGTGGCCATCTACCGATATTCCACTCGATAATGAAGCTTTTGCACTTCCCAAGGGTTATAATGCTCCCCAGCAAGTGCACATC
ACACAGGGTGACTATGATGGGAAGGCAGTTATAATCTCTTGGGTGACACCTGATGAACCAGGATCCGGCCAAGTGCGATATGGCATATCA
GAAGGAAAATATGATTTTACTGCAAAGGGGACAGTTAAAAACTACACATTCCACAACTACAAGTCTGGATATATCCACAAGTGTCTTGTT
GATGGTCTTGAGTATGACACGAAGTACTACTATGAGATTGGAGATCATGATTCTGCAAGGAAATTTTGGTTTCAAACACCTCCAAGAATT
GATCCAGATGCTTCCTACAAGTTTGGAATCATAGGTGATCTGGGTCAAACATACAATTCTCTTTCAACTCTTGAACATTATAAGCGGAGT
GGTGGACAAACTGTCTTATTTGTCGGGGATCTCTCTTATGCTGATAGATACCAGTATCATGATGTTGGTGTGCGTTGGGACACATGGGGT
CGTTTCATTGAGCAGAGTGCAGCATACCAGCCATGGATATGGTGCGCTGGAAATCATGAGATTGAGTACATGCCATATATGGGAGAAGTA
ACTCCATTCAAGTCATATCTCCACAGATACCCTACACCTTATCCAGCCTCCAAAAGCAGTGATCCTCTTTGGTATGCTATCCGGCGTGGA
TCAGCTCATGTAATTGTCCTGTCTAGTTATTCTCCCTTTGTCAAATATACACCGCAGTGGAGGTGGCTTGCAGAAGAACTCAAAAGGGTT
GACCGGAAGAAGACTCCTTGGCTCATTGTCTTGATGCATGTTCCAATTTACAACAGTAATGAAGCCCATTTCATGGAAGGAGAAAGTATG
AGAACAGTATTTGAGAGTTGGTTTGTTAAGTATAAAGTTGATGTAGTCTTTGCAGGCCATGTCCATGCTTATGAAAGATCGTATCGCATC
TCCAACATACACTACAATGTATCAAGTGGATATCCTTACCCTGTACCTGAAAATCAGCTCCCTGTTAATATTACCGTAGGGGATGGAGGA
AATCAGGAAGXX
Edits in Original Sequence 
(5')XXGAATGGTGACTGGCACCCCTTAAAGACTCCgTCCCGACAGAAAACCACAAACGAACCCAACCAACCaACCATAACTCACTGAGT
TCTCCCCACTCATTTCCGTCCGTCCGTCCGTCCATCCCAACGCCGTTCATCAGCATACCATTATCAAGCACACACAGTACATACTATATA
GATACAGCTCTGATTATCGGATCAACTGCTCGTTCCCCTCTTGCACCTTCTTGTATTGATXTTGATTTGAGTAGTGCAGGAGGAXTAAGG
GAGAAATCAAATGTTATCGAACCGCATTTGGCTGCTGTTTTCTATTTTGTTGAgTTTCGTACACAATGGGATTGCGGGTTTAACCAGTAG
CTTTATTCGTTCCGAGTGGCCATCTACCGATATTCCACTCGATAATGAAGCTTTTGCACTTCCCAAGGGTTATAATGCTCCCCAGCAAGT
GCACATCACACAGGGTGACTATGATGGGAAGGCAGTTATAATCTCTTGGGTGACACCTGATGAACCAGGATCCGGCCAAGTGCGATATGG
CATATCAGAAGGAAAATATGATTTTACTGCAAAGGGGACAGTTAAAAACTACACATTCCACAACTACAAGTCTGGATATATCCACAAGTG
TCTTGTTGATGGTCTTGAGTATGACACGAAGTACTACTATGAGATTGGAGATCATGATTCTGCAAGGAAATTTTGGTTTCAAACACCTCC
AAGAATTGATCCAGATGCTTCCTACAAGTTTGGAATCATAGGTGATCTGGGTCAAACATACAATTCTCTTTCAACTCTTGAACATTATAA
GCGGAGTGGTGGACAAACTGTCTTATTTGTCGGGGATCTCTCTTATGCTGATAGATACCAGTATCATGATGTTGGTGTGCGTTGGGACAC
ATGGGGTCGTTTCATTGAGCAGAGTGCAGCATACCAGCCATGGATATGGTGCGCTGGAAATCATGAGATTGAGTACATGCCATATATGGG
AGAAGTAACTCCATTCAAGTCATATCTCCACAGATACCCTACACCTTATCCAGCCTCCAAAAGCAGTGATCCTCTTTGGTATGCTATCCG
GCGTGGATCAGCTCATGTAATTGTCCTGTCTAGTTATTCTCCCTTTGTCAAATATACACCGCAGTGGAGGTGGCTTGCAGAAGAACTCAA
AAGGGTTGACCGGAAGAAGACTCCTTGGCTCATTGTCTTGATGCATGTTCCAATTTACAACAGTAATGAAGCCCATTTCATGGAAGGAGA
AAGTATGAGAACAGTATTTGAGAGTTGGTTTGTTAAGTATAAAGTTGATGTAGTCTTTGCAGGCCATGTCCATGCTTATGAAAGATCGTA
TCGCATCTCCAACATACACTACAATGTATCAAGTGGATATCCTTACCCTGTACCTGAcAAATCAGCTCCCTGTTAATATTACCGTAGGGG
ATGGAGGAAATCAGGAAGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan