ESTScan Details for Unigene SGN-U620346

Score 
548
Direction 
Forward
Predicted Peptide Sequence 
ADIEEGTTVAIFGLGVIGLAVAEGARLRGAKTIIGVDLNPDKVEIGKKFGITHFINPRELGGKLASEVILEMTDGLGADYCFECVGLPSL
SQEAFTCCRKGWGKTIILGVDKPDSQFILNSLVNNHSGKTITGVQYGGLKPNLDIAILAKRYLDKELQLDLFVTHEIKLEDINKAFKLLI
EGKCLRTVIWFDQERAKADGVTFK*
Predicted Coding Sequence 
GCCGATATTGAAGAGGGTACAACTGTAGCTATTTTTGGATTGGGAGTAATTGGATTGGCGGTTGCTGAAGGAGCAAGACTTCGTGGAGCT
AAGACAATTATCGGTGTGGATCTGAACCCCGACAAAGTTGAAATAGGTAAAAAGTTTGGCATCACCCATTTTATCAACCCAAGGGAACTT
GGCGGCAAACTTGCGAGCGAGGTGATTCTTGAGATGACTGATGGCCTTGGTGCTGATTACTGCTTTGAATGCGTGGGCTTGCCATCCCTA
TCACAAGAAGCATTTACTTGCTGCAGAAAGGGATGGGGAAAGACCATCATATTAGGAGTGGACAAGCCAGACTCGCAGTTTATCCTCAAT
TCCCTAGTGAATAATCATAGCGGGAAGACCATCACAGGAGTCCAATATGGTGGTCTCAAGCCTAATCTTGATATTGCCATTCTTGCAAAA
CGTTACTTGGATAAGGAGCTTCAGTTGGACTTGTTTGTCACGCATGAGATCAAACTTGAAGACATCAACAAGGCTTTCAAGTTGCTCATT
GAGGGCAAGTGCCTCCGGACTGTCATTTGGTTCGATCAGGAGAGGGCAAAAGCCGATGGTGTGACCTTTAAATGA
Edits in Original Sequence 
(5')GCCGATATTGAAGAGGGTACAACTGTAGCTATTTTTGGATTGGGAGTAATTGGATTGGCGGTTGCTGAAGGAGCAAGACTTCGTGG
AGCTAAGACAATTATCGGTGTGGATCTGAACCCCGACAAAGTTGAAATAGGTAAAAAGTTTGGCATCACCCATTTTATCAACCCAAGGGA
ACTTGGCGGCAAACTTGCGAGCGAGGTGATTCTTGAGATGACTGATGGCCTTGGTGCTGATTACTGCTTTGAATGCGTGGGCTTGCCATC
CCTATCACAAGAAGCATTTACTTGCTGCAGAAAGGGATGGGGAAAGACCATCATATTAGGAGTGGACAAGCCAGACTCGCAGTTTATCCT
CAATTCCCTAGTGAATAATCATAGCGGGAAGACCATCACAGGAGTCCAATATGGTGGTCTCAAGCCTAATCTTGATATTGCCATTCTTGC
AAAACGTTACTTGGATAAGGAGCTTCAGTTGGACTTGTTTGTCACGCATGAGATCAAACTTGAAGACATCAACAAGGCTTTCAAGTTGCT
CATTGAGGGCAAGTGCCTCCGGACTGTCATTTGGTTCGATCAGGAGAGGGCAAAAGCCGATGGTGTGACCTTTAAATGA(3')AATATAG
GAGAGTAGACTAACNAATACTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan