ESTScan Details for Unigene SGN-U620999

Score 
465
Direction 
Forward
Predicted Peptide Sequence 
XPAFKEYAEKYAADQEAFFKDYAEAHAKLSNLGAKFDPPEGFSIDEGTSQPQPEKFVAANYSTGKVAXEIRVSSFLAVCFNNXKMKLFPN
PVNSNLNFGSLVKEKNKFNEYCLFDLQSELSEAMKQKIRAEYEGLGGSPDKPLXVKLFSQYYDRNRCLGYFDILAW
Predicted Coding Sequence 
XXGCCTGCATTTAAGGAATATGCTGAGAAGTATGCAGCAGATCAAGAAGCATTTTTCAAAGATTATGCTGAGGCTCATGCTAAACTTAGC
AACCTTGGAGCCAAGTTTGATCCTCCTGAGGGTTTCTCTATTGATGAGGGTACATCACAACCTCAGCCAGAGAAGTTTGTTGCAGCCAAT
TACTCAACGGGAAAGGTTGCTTAXGAAATACGAGTGTCTTCTTTTCTTGCCGTTTGTTTTAATAACAXCAAGATGAAGCTATTTCCAAAT
CCTGTGAACTCAAATCTAAATTTTGGAAGTCTTGTCAAGGAGAAGAATAAATTCAATGAGTATTGCCTATTTGACTTGCAGAGCGAGCTC
TCAGAAGCTATGAAGCAAAAGATAAGGGCAGAATATGAAGGATTGGGGGGAAGCCCAGATAAGCCTCTCXCCGTCAAACTATTTTCTCAA
TATTATGATCGTAATAGGTGTCTTGGCTATTTTGACATCCTTGCTTGG
Edits in Original Sequence 
(5')XXGCCTGCATTTAAGGAATATGCTGAGAAGTATGCAGCAGATCAAGAAGCATTTTTCAAAGATTATGCTGAGGCTCATGCTAAACT
TAGCAACCTTGGAGCCAAGTTTGATCCTCCTGAGGGTTTCTCTATTGATGAGGGTACATCACAACCTCAGCCAGAGAAGTTTGTTGCAGC
CAATTACTCAACGGGAAAGGTTGCTTAXGAAATACGAGTGTCTTCTTTTCTTGCCGTTTGTTTTAATAACAXCAAGATGAAGCTATTTCC
AAATCCTGTGAACTCAAATCTAAATTTTGGAAGTCTTGtTCAAGGAGAAGAATAAATTCAATGAGTATTGCCTATTTGACTTGCAGAGCG
AGCTCTCAGAAGCTATGAAGCAAAAGATAAGGGCAGAATATGAAGGATTGGGGGGAAGCCCAGATAAGCCTCTCXCCGTCAAACTATTTT
CTCAATATTATGATCGTAATAGGTGTCTTGGCTATTTTGACATCCTTGCTTGG(3')AAACTAAGATGATTTGGAACTTTGTTGATTTGC
TTATTTTGCGTGTTTAGCATTGTTATTATGGG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan