ESTScan Details for Unigene SGN-U621047

Score 
180
Direction 
Forward
Predicted Peptide Sequence 
XFTSYDEVSDSFDSMVFLDTLLRGISPYGFDKPSAIQQRGIVPFCX
Predicted Coding Sequence 
XTCTTCACTTCTTATGATGAGGTTTCTGACAGTTTTGATTCAATGGTTTTTCTTGACACCCTTCTCAGGGGCATTTCTCCTTATGGTTTT
GACAAGCCCTCTGCTATTCAACAAAGGGGAATTGTTCCTTTTTGCAXX
Edits in Original Sequence 
(5')XTCTTCACTTCTTATGATGAGGTTTCTGACAGTTTTGATTCAATGGTTTTTCTTGACACCCTTCTCAGGGGCATTTCTCCTTATGG
TTTTGACAAGCCCTCTGCTATTCAACAAAGGGGAATTGTTCCTTTTTGCAXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan