ESTScan Details for Unigene SGN-U621177

Score 
386
Direction 
Forward
Predicted Peptide Sequence 
XKKLLLILYCGVGKSCLLLLFSDGSFSTLFPPSIGIDLPIPAFELDGLRIRLHIWDSAGQERFKSITTANYRGAMVLLWVYDVTDESSFN
NIRNWIRNIEQHASEGVNKILVGNKADMDESRGAVPTSKGQALADEYGIKFFETSAKTNLNVEEVFFSIARDIKQRLADTDSKAEASQSK
LST
Predicted Coding Sequence 
XTCAAAAAACTTCTACTCATCCTCTATTGTGGTGTGGGAAAGAGTTGCCTTCTTTTGCTTTTTTCAGATGGTTCCTTCTCTACCCTTTTT
CCCCCTTCCATAGGAATTGACCTCCCGATACCAGCCTTTGAGCTAGATGGCTTGCGAATCAGACTCCATATCTGGGATTCTGCTGGCCAG
GAGCGGTTCAAATCGATCACCACTGCTAATTATCGGGGAGCTATGGTATTATTGTGGGTCTATGATGTTACTGATGAATCATCCTTCAAT
AATATTAGGAACTGGATTCGTAACATTGAACAGCATGCATCTGAGGGTGTCAACAAGATTCTGGTAGGGAACAAGGCTGACATGGATGAA
AGCAGGGGGGCTGTCCCTACCTCAAAGGGTCAAGCACTTGCTGATGAGTACGGTATCAAATTTTTTGAGACTAGTGCAAAAACAAATCTT
AATGTGGAAGAAGTTTTCTTTTCAATAGCAAGGGACATTAAGCAAAGGCTTGCAGACACGGACTCTAAAGCGGAGGCTTCACAATCAAAA
TTATCAACC
Edits in Original Sequence 
(5')XTCAAAAAACTTCTACTCATCCTCTATTGTGGTGTGGGAAAGAGTTGCCTTCTTTTGCTTTTTTCAGATGGTTCCTTCTCTACCCT
TTTTCCCCCTTCCATAGGAATTGACCTCCCGATACCAGCCTTTGAGCTAGATGGCTTGCGAATCAGACTCCATATCTGGGATTCTGCTGG
CCAGGAGCGGTTCAAATCGATCACCACTGCTAATTATCGGGGAGCTATGGTATTATTGTGGGTCTATGATGTTACTGATGAATCATCCTT
CAATAATATTAGGAACTGGATTCGTAACATTGAACAGCATGCATCTGAGGGTGTCAACAAGATTCTGGTAGGGAACAAGGCTGACATGGA
TGAAAGCAGGGGGGCTGTCCCTACCTCAAAGGGTCAAGCACTTGCTGATGAGTACGGTATCAAATTTTTTGAGACTAGTGCAAAAACAAA
TCTTAATGTGGAAGAAGTTTTCTTTTCAATAGCAAGGGACATTAAGCAAAGGCTTGCAGACACGGACTCTAAAGCGGAGGCTTCACAATC
AAAATTATCAACC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan