ESTScan Details for Unigene SGN-U621724

Score 
20
Direction 
Reverse
Predicted Peptide Sequence 
MGIQHFFTDIRGRQPPPTSKIPLFGFYSTDLNIEXPKLTSITRTPAQYATLGARHNSNILHATELNYTPIMHSVSSSPSKVTTYLHPGGF
HYNWLAILFSASFWTNQQSSQVPSAVQIFVLS*
Predicted Coding Sequence 
ATGGGAATCCAGCATTTTTTTACAGATATACGAGGCAGACAACCTCCACCAACATCCAAAATACCATTATTCGGTTTCTATTCCACAGAT
TTGAACATTGAAXCACCAAAATTAACATCGATCACTAGAACACCAGCTCAATATGCTACACTTGGGGCCAGACACAACTCAAATATATTG
CACGCGACCGAATTAAACTATACTCCTATTATGCACAGTGTTTCTAGTAGTCCAAGCAAAGTCACGACGTATTTACATCCAGGTGGTTTC
CACTATAACTGGTTAGCTATATTATTCAGTGCTTCATTTTGGACTAATCAGCAGTCCTCCCAAGTACCCTCCGCAGTTCAGATTTTTGTT
CTGAGCTGA
Edits in Original Sequence 
CTCCATGTACCATCAATCAAAATAAAATTCAGTCTTTCATCTCCAAGTACCGAATTCTGTTCAGACTGATGATCCCTGGAGGAATTTTTG
AATGAATGTGTCCTGAACAGACATCGGCATAGCATTCTTATTAGGGTAGAGACACCAAACATTTCTTCTCCCTGAAAAGTTCAATGCACT
CCACATGATTTCTTCAAGTTCAGAAATGCCAAAGAGACACAAAGTTGCAGCATGGGTGCCAAACACTTGACATAACAACTTTCCCGTGTT
GTTCTGTCGTAAAAAATCCTTTGGTTGCATAAACAACCACAAACGTATCTGATTCCAAACCCGAAAAGGCAGAAGTGTGACACGCCCCCC
CCCTTCC
(5')ATGGGAATCCAGCATTTTTTTACAGATATACGAGGCAGACAACCTCCACCAACATCCAAAATACCATTATTCGGTTTCT
ATTCCACAGATTTGAACATTGAAXCACCAAAATTAACATCGATCACTAGAACACCAGCTCAATATGCTACACTTGGGGCCAGACACAACT
CAAATATATTGCACGCGACCGAATTAAACTATACTCCTATTATGCACAGTGTTTcCTAGTAGTCCAAGCAAAGTCACGACGTATTTACAT
CCAGGTGcGTTTCCACTATAACTGGTTAGCTATATTATTCAGTGCTTCATTTTGGACTAATCAGCAGTCCTCCCAAGTACCCTCCGCAGT
TCAGATTTTTGTTCTGAGCTGA(3')GCCTGGATGGGAATTTTATATCAAACTTAATCCTCAAATTTCCTTTCTTC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan