ESTScan Details for Unigene SGN-U623335

Score 
292
Direction 
Reverse
Predicted Peptide Sequence 
XKVGDFDRAKSLMDELLHSYEDVNIYNNKQQQNSDQGENKESLVRRLDVQPNLITYTTLISTYCKQHGVEEVLAIYEELIVAGLFPDVVT
YSTVICALCKAGRIAEAKLLFEEMKMVGVDPNHVTYSILVDTLFKAGNGIAADSIQSQMVVRGIAFDXGGVYNFDGWAFQAS
Predicted Coding Sequence 
XGTAAAGTAGGAGATTTTGACAGGGCCAAGAGTCTCATGGATGAGCTCTTGCATTCTTATGAGGATGTAAACATTTATAACAATAAGCAA
CAACAGAACAGTGATCAGGGTGAAAATAAGGAATCTTTGGTTAGACGGTTGGATGTTCAACCAAATCTAATAACGTATACAACATTGATT
AGTACGTACTGCAAGCAGCATGGAGTTGAAGAAGTACTTGCCATATACGAGGAATTGATTGTGGCAGGGTTGTTTCCTGATGTAGTTACA
TATAGTACAGTTATATGTGCTCTTTGTAAGGCTGGGAGAATTGCTGAAGCCAAATTACTTTTTGAGGAGATGAAAATGGTGGGAGTGGAT
CCCAATCATGTCACTTATTCAATCCTTGTGGATACTTTATTTAAAGCTGGGAATGGCATAGCTGCAGATAGTATACAGAGTCAAATGGTA
GTTCGTGGTATTGCCTTTGATGXTGGTGGTGTTTACAACTTTGATGGATGGGCTTTTCAAGCTAGC
Edits in Original Sequence 
(5')XGTAAAGTAGGAGATTTTGACAGGGCCAAGAGTCTCATGGATGAGCTCTTGCATTCTTATGAGGATGTAAACATTTATAACAATAA
GCAACAACAGAACAGTGATCAGGGTGAAAATAAGGAATCTTTGGTTAGACGGTTGGATGTTCAACCAAATCTAATAACGTATACAACATT
GATTAGTACGTACTGCAAGCAGCATGGAGTTGAAGAAGTACTTGCCATATACGAGGAATTGATTGTGGCAGGGTTGTTTCCTGATGTAGT
TACATATAGTACAGTTATATGTGCTCTTTGTAAGGCTGGGAGAATTGCTGAAGCCAAATTACTTTTTGAGGAGATGAAAATGGTGGGAGT
GGATCCCAATCATGTCACTTATTCAATCCTTGTGGATACTTTATTTAAAGCTGGGAATGGCATAGCTGCAGATAGTATACAGAGTCAAAT
GGTAGTTCGTGGTATTGCCTTTGATGXTGGTGGTGTTTACAACTTTGATGGATGGGCTTTTCAAGCTAGC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan