Notice: If you try to use Google Chrome to access the SGN FTP site, please check this link to resolve connection issues.

ESTScan Details for Unigene SGN-U623838

Score 
199
Direction 
Forward
Predicted Peptide Sequence 
XLQDALCKTFSVKKKKGKLRKAWDGSKVIYNVASWGATAIGIYQNPAILKAASAASGLPACNIKALLSSVAHFAGINRXACAAKSASLFF
RNV*
Predicted Coding Sequence 
XXGCTTCAGGATGCCCTTTGCAAGACATTTTCTGTAAAAAAGAAAAAGGGAAAACTTCGGAAGGCTTGGGATGGGAGCAAAGTTATCTAC
AATGTGGCATCCTGGGGAGCTACAGCCATTGGCATATACCAAAACCCAGCGATTCTGAAGGCTGCCTCAGCAGCATCTGGACTTCCTGCC
TGTAATATCAAAGCTCTTCTGAGCAGTGTGGCACACTTTGCGGGAATCAATCGTGXTGCTTGTGCTGCCAAAAGTGCTTCCCTATTCTTT
AGAAATGTGTAA
Edits in Original Sequence 
(5')XXGCTTCAGGATGCCCTTTGCAAGACATTTTCTGTAAAAAAGAAAAAGGGAAAACTTCGGAAGGCTTGGGATGGGAGCAAAGTTAT
CTACAATGTGGCATCCTGGGGAGCTACAGCCATTGGCATATACCAAAACCCAGCGATTCTGAAGGCTGCCTCAGCAGCAtTCTGGACTTC
CTGCCgTGTAATATCAAAGCTCTTCTGAGCAGTGTGGCACACTTTGCGGGAATCAATCGTGXTGCTTGTGCTGCCAAAAGTGCTTCCCTA
TTCTTTAGAAATGTGTAA(3')CATAAATGCCATTCATTGTGTGTGTGTGTGTGTTGCAATTGATAGCTCCAATGTTGTTTAACCCTGTA
AATATTCTTTCAATGAATACTTGTCGTCTTCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan