ESTScan Details for Unigene SGN-U623970

Score 
715
Direction 
Forward
Predicted Peptide Sequence 
XMHVHLLASRESYLGRSTLRLDYLTLLSKQLTHPVRVLPKDEAVEKVVNFMDSYSISQEDFDTILEISKFKGHPSPMDGVQPAVKAALTK
AYKIGTDSRKIRTADMVTVQKRDGSSSHVIKTADMVPGTKKALKKRVAAMLEPVEESLAEENGDALEENEENSSDAEDLEDSDNTDKGLQ
ADLQSLKSKGIEVQLNLKVSENSSAKKGSSARGKRSSEPAEKKGGGGDPDLRPRGRDENLVGQDFYYQFDSTLVVNNVFVIAALVLVLKF
RVVX
Predicted Coding Sequence 
XGCATGCATGTCCATCTACTTGCATCTCGTGAATCTTATTTGGGCAGGTCGACATTGCGATTGGACTACCTTACTCTTCTTTCTAAGCAG
TTGACCCATCCAGTACGAGTGCTGCCCAAGGATGAAGCTGTAGAGAAGGTAGTAAATTTCATGGATTCATACTCCATCAGTCAGGAAGAT
TTTGATACTATATTGGAGATATCCAAGTTCAAGGGGCATCCAAGTCCTATGGATGGAGTTCAGCCTGCTGTCAAAGCAGCTCTAACAAAG
GCTTACAAAATAGGGACGGACTCACGTAAGATTCGGACAGCGGATATGGTGACTGTCCAGAAAAGAGATGGAAGCAGCTCACATGTGATT
AAGACTGCAGATATGGTTCCTGGGACAAAGAAGGCCCTTAAGAAACGGGTTGCTGCAATGCTGGAACCAGTGGAAGAAAGTTTAGCAGAG
GAGAATGGTGATGCATTAGAAGAAAATGAAGAGAATTCTTCAGACGCAGAAGACTTGGAAGACTCAGATAATACAGATAAAGGGCTGCAA
GCAGATCTCCAAAGCCTGAAGTCGAAAGGCATTGAAGTACAACTGAACTTGAAAGTTTCTGAAAATTCGAGTGCCAAGAAGGGATCTTCA
GCAAGAGGAAAACGCAGTTCTGAACCTGCAGAAAAGAAAGGTGGAGGAGGGGATCCGGATCTGCGTCCAAGAGGAAGAGATGAAAATTTA
GTTGGTCAAGACTTTTACTATCAGTTTGACTCGACGTTGGTTGTGAATAATGTTTTTGTCATTGCCGCCCTCGTTTTGGTTCTGAAATTT
AGGGTGGTTGAX
Edits in Original Sequence 
(5')XGCATGCATGTCCATCTACTTGCATCTCGTGAATCTTATTTGGGCAGGTCGACATTGCGATTGGACTACCTTACTCTTCTTTCTAA
GCAGTTGACCCATCCAGTACGAGTGCTGCCCAAGGATGAAGCTGTAGAGAAGGTAGTAAATTTCATGGATTCATACTCCATCAGTCAGGA
AGATTTTGATACTATATTGGAGATATCCAAGTTCAAGGGGCATCCAAGTCCTATGGATGGAGTTCAGCCTGCTGTCAAAGCAGCTCTAAC
AAAGGCTTACAAAATAGGGACGGACTCACGTAAGATTCGGACAGCGGATATGGTGACTGTCCAGAAAAGAGATGGAAGCAGCTCACATGT
GATTAAGACTGCAGATATGGTTCCTGGGACAAAGAAGGCCCTTAAGAAACGGGTTGCTGCAATGCTGGAACCAGTGGAAGAAAGTTTAGC
AGAGGAGAATGGTGATGCATTAGAAGAAAATGAAGAGAATTCTTCAGACGCAGAAGACTTGGAAGACTCAGATAATACAGATAAAGGGCT
GCAAGCAGATCTCCAAAGCCTGAAGTCGAAAGGCATTGAAGTACAACTGAACTTGAAAGTTTCTGAAAATTCGAGTGCCAAGAAGGGATC
TTCAGCAAGAGGAAAACGCAGTTCTGAACCTGCAGAAAAGAAAGGTGGAGGAcGGGGATCCGGATCTGCGTCCAAGAGGAAGAGATGAAA
ATTTAGTTGGTCAAGACTTTTACTATCAGTTTGACTCGACGTTGGTTGTGAATAATGTTTTTGTCATTGCCGCCCTCGTTTTGGTTCTGA
AATTTAGGGTGGTTGAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan