ESTScan Details for Unigene SGN-U625636

Score 
677
Direction 
Forward
Predicted Peptide Sequence 
MSSRLALHHGRHLSTSAAAAATAAVEAAGASTATSTKPSTISTSRAKSQLRYVYDPDKALEIYSSVSPNYTSPLSSRYTQEYTVRRLAKS
HRFSDIENFLESHKNDPKITQEPFLSSLIRSYGLAGMFDHALKTFNEMDDLGTPRSTVSFNALLSACNSSKNFGRAPELFDEVPQRYGLS
PDKFSYGNLIKAYCEMGSPESAAGKAEGNGG
Predicted Coding Sequence 
ATGTCTTCCCGTCTCGCCCTCCACCACGGCCGCCACCTTTCAACTTCCGCCGCCGCCGCTGCCACCGCAGCCGTCGAAGCAGCAGGGGCT
TCTACTGCCACCTCCACAAAGCCGTCTACCATCAGCACTTCCAGAGCCAAATCACAACTCAGATACGTCTACGACCCCGACAAAGCCCTC
GAAATCTACTCTTCAGTCTCCCCTAACTATACCTCTCCGCTCTCCTCTCGCTACACCCAAGAGTACACCGTCCGCCGCCTCGCCAAATCC
CACAGATTCTCTGACATCGAAAACTTCCTCGAATCTCACAAAAATGACCCCAAAATCACTCAAGAACCATTCCTTTCTTCCCTCATTCGA
TCCTATGGTCTTGCTGGTATGTTTGATCATGCCCTCAAAACTTTTAATGAAATGGATGATCTGGGTACCCCCAGGTCAACTGTTTCCTTC
AATGCTCTCCTTTCTGCTTGCAATTCGTCCAAAAATTTTGGACGAGCCCCTGAGCTGTTCGATGAAGTGCCTCAAAGATATGGGCTTTCG
CCGGATAAGTTTTCATATGGGAATCTGATCAAGGCTTATTGTGAAATGGGATCGCCCGAATCAGCXGCTGGAAAGGCTGAAGGAAATGGA
GGX
Edits in Original Sequence 
GCTTAAATTCCCCTAAAACTTTCCCTTTATTTACGAAGCCATGCCTTCCCCCTTTCATTACTAGTTACGAATCCTCAAAAGATCCATAAC
AAAACACCTAAAACCCTAGAAG
(5')ATGTCTTCCCGTCTCGCCCTCCACCACGGCCGCCACCTTTCAACTTCCGCCGCCGCCGCTGCCA
CCGCAGCCGTCGAAGCAGCAGGGGCTTCTACTGCCACCTCCACAAAGCCGTCTACCATCAGCACTTCCAGAGCCAAATCACAACTCAGAT
ACGTCTACGACCCCGACAAAGCCCTCGAAATCTACTCTTCAGTCTCCCCTAACTATACCTCTCCGCTCTCCTCTCGCTACACCCAAGAGT
ACACCGTCCGCCGCCTCGCCAAATCCCACAGATTCTCTGACATCGAAAACTTCCTCGAATCTCACAAAAATGACCCCAAAATCACTCAAG
AACCATTCCTTTCTTCCCTCATTCGATCCTATGGTCTTGCTGGTATGTTTGATCATGCCCTCAAAACTTTTAATGAAATGGATGATCTGG
GTACCCCCAGGTCAACTGTTTCCTTCAATGCTCTCCTTTCTGCTTGCAATTCGTCCAAAAATTTTGGACGAGCCCCTGAGCTGTTCGATG
AAGTGCCTCAAAGATATGGGCTTTCGCCGGATAAGTTTTCATATGGGAATCTGATCAAGGCTTATTGTGAAATGGGATCGCCCGAATCAG
CXGCTGGAAAGGCTGAAGGAAATGGAGGX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan