ESTScan Details for Unigene SGN-U625805

Score 
468
Direction 
Forward
Predicted Peptide Sequence 
QEHLEEQRKRKAIEACSETQAKMDALENELSNIVGLDELKVQLRKWAKGMLLDERRRALGLKVGARRAPHMAFLGNPGTGKTMVARVLGK
LLHMVGILPTDSVTEVQRTDLVGEFVGHTGPKTRRKIQEAEGGILFVDEAYRLIPMQKADDKDYGVEALEEIMSVMDSGKVVVIFAGYSE
PMKRVISSNEGFCRRVTKFFIFNDFSSEDLAKILHLRMTNQVENTLLYGFKVPPSCSIDA
Predicted Coding Sequence 
CAGGAACACCTTGAAGAGCAGAGAAAGCGTAAAGCTATTGAAGCATGCAGCGAGACTCAAGCAAAGATGGATGCACTGGAAAATGAGTTA
TCAAACATAGTTGGACTAGATGAGCTCAAAGTACAACTCCGAAAATGGGCAAAGGGGATGCTCTTGGATGAGAGGCGACGCGCACTTGGA
CTAAAAGTTGGTGCTAGAAGGGCACCTCACATGGCCTTCTTGGGAAATCCTGGAACAGGTAAGACTATGGTAGCACGAGTGCTTGGAAAA
TTACTCCACATGGTTGGAATTCTTCCTACCGACAGTGTAACAGAAGTGCAGCGAACAGATTTAGTTGGGGAGTTTGTGGGTCACACAGGA
CCAAAGACAAGGAGAAAGATACAAGAAGCTGAAGGTGGAATTCTTTTCGTGGATGAAGCCTACAGACTCATACCCATGCAGAAGGCAGAT
GATAAAGACTACGGGGTGGAGGCTCTAGAAGAAATAATGTCAGTCATGGATAGTGGAAAAGTTGTTGTAATCTTTGCTGGCTACAGTGAA
CCAATGAAGCGCGTGATTTCTTCAAATGAAGGCTTCTGCAGAAGGGTAACAAAGTTTTTTATTTTTAACGACTTCAGTTCTGAGGATCTT
GCCAAGATTCTTCATCTTAGAATGACTAATCAAGTTGAGAATACCTTGCTGTATGGATTTAAGGTGCCCCCCTCGTGTAGCATAGATGCX
Edits in Original Sequence 
(5')CAGGAACACCTTGAAGAGCAGAGAAAGCGTAAAGCTATTGAAGCATGCAGCGAGACTCAAGCAAAGATGGATGCACTGGAAAATGA
GTTATCAAACATAGTTGGACTAGATGAGCTCAAAGTACAACTCCGAAAATGGGCAAAGGGGATGCTCTTGGATGAGAGGCGACGCGCACT
TGGACTAAAAGTTGGTGCTAGAAGGGCACCTCACATGGCCTTCTTGGGAAATCCTGGAACAGGTAAGACTATGGTAGCACGAGTGCTTGG
AAAATTACTCCACATGGTTGGAATTCTTCCTACCGACAGTGTAACAGAAGTGCAGCGAACAGATTTAGTTGGGGAGTTTGTGGGTCACAC
AGGACCAAAGACAAGGAGAAAGATACAAGAAGCTGAAGGTGGAATTCTTTTCGTGGATGAAGCCTACAGACTCATACCCATGCAGAAGGC
AGATGATAAAGACTACGGGGTGGAGGCTCTAGAAGAAATAATGTCAGTCATGGATAGTGGAAAAGTTGTTGTAATCTTTGCTGGCTACAG
TGAACCAATGAAGCGCGTGATTTCTTCAAATGAAGGCTTCTGCAGAAGGGTAACAAAGTTTTTTATTTTTAACGACTTCAGTTCTGAGGA
TCTTGCCAAGATTCTTCATCTTAGAATGACTAATCAAGTTGAGAATACCTTGCTGTATGGATTTAAGGTGCCCCCCTCGTGTAGCATAGA
TGCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan