ESTScan Details for Unigene SGN-U626180

Score 
393
Direction 
Forward
Predicted Peptide Sequence 
XKDGNQQGPXELLVEMVKKDLLPDTYTYRPLISGLCLAGRVTEAREFFDNXPSEALQAKRDVLFCPSAGYCKEGRLKDALKACREMVESG
IHMDLICYAVLICGTLKQHDADKLLCVMKEMHDQGLKPDDVIYTSMIDAYGKAGDLKTALGYWDIMVHENCIPNIVTYTVMINGLCKAGL
IDKAENLCKEMLASGLIPNQITYGCFLDQLTREGCXGEAMNYTCNGQRSL
Predicted Coding Sequence 
XGCAAGGATGGAAACCAGCAAGGGCCTXTTGAGTTGCTTGTTGAGATGGTGAAAAAGGATCTTTTACCTGATACATATACTTATAGGCCT
CTGATAAGTGGCCTTTGTCTGGCAGGTAGAGTAACTGAAGCCAGAGAATTCTTTGACAACAXTCCATCGGAAGCATTGCAAGCTAAACGA
GATGTGCTTTTCTGCCCTTCTGCTGGTTACTGTAAGGAAGGAAGGTTGAAGGATGCACTGAAAGCCTGTCGGGAAATGGTGGAAAGTGGA
ATACACATGGACCTTATATGTTATGCTGTACTTATATGTGGAACTTTAAAACAGCATGATGCTGATAAATTATTGTGTGTTATGAAGGAG
ATGCATGACCAGGGATTGAAGCCTGATGATGTAATTTACACAAGCATGATTGATGCATATGGTAAAGCTGGAGATTTAAAGACTGCGTTG
GGATATTGGGACATAATGGTGCATGAAAACTGCATTCCAAATATTGTGACGTATACTGTAATGATTAATGGTCTGTGTAAGGCAGGATTG
ATTGACAAGGCTGAGAATCTTTGTAAAGAAATGCTAGCTAGTGGTCTGATTCCTAATCAGATTACTTATGGTTGCTTCCTTGATCAGCTC
ACCAGAGAAGGGTGCAXTGGTGAAGCAATGAACTACACATGCAATGGTCAGAGGTCTCTX
Edits in Original Sequence 
(5')XGCAAGGATGGAAACCAGCAAGGGCCTXTTGAGTTGCTTGTTGAGATGGTGAAAAAGGATCTTTTACCTGATACATATACTTATAG
GCCTCTGATAAGTGGCCTTTGTCTGGCAGGTAGAGTAACTGAAGCCAGAGAATTCTTTGACAACAXTCCATCGGAAGCATTGCAAGCTAA
ACGAGATGTGCTTTTCTGCCCTTCTGCaTGGTTACTGTAAGGAAGGAAGGTTGAAGGATGCACTGAAAGCCTGTCGGGAAATGGTGGAAA
GTGGAATACACATGGACCTTATATGTTATGCTGTACTTATATGTGGAACTTTAAAACAGCATGATGCTGATAAATTATTGTGTGTTATGA
AGGAGATGCATGACCAGGGATTGAAGCCTGATGATGTAATTTACACAAGCATGATTGATGCATATGGTAAAGCTGGAGATTTAAAGACTG
CGTTGGGATATTGGGACATAATGGTGCATGAAAACTGCATTCCAAATATTGTGACGTATACTGTAATGATTAATGGTCTGTGTAAGGCAG
GATTGATTGACAAGGCTGAGAATCTTTGTAAAGAAATGCTAGCTAGTGGTCTGATTCCTAATCAGATTACTTATGGTTGCTTCCTTGATC
AGCTCACCAGAGAAGGGTGCAXTGGTGAAGCAATGAACTACACATGCAATGGTCAGAGGTCTCTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan