ESTScan Details for Unigene SGN-U628166

Score 
520
Direction 
Forward
Predicted Peptide Sequence 
XPEEVLDLIEGSELWLEKAILYRKLGQETLXAPNIGLEAGGLEAAEQYCAEIGRPDAYMQLLEMYLDPKDGKEPMFKAAVRLLHNHGEAL
DPLQVLERLSPDMPLQLASDTILRMLRARLHHHRQGQIVHNLSRALDVDASLARLEERSRHVLINDESVCDSCHARLGTKLFAMYPDDTI
AAISVFVVKVNPPLSQXRNFEEDVLYKPGWLEHGDHGKADDLLCLELAAWHDQELRLHMQLX
Predicted Coding Sequence 
XGCCCAGAAGAGGTCCTTGACTTGATTGAAGGATCCGAATTGTGGCTGGAAAAGGCTATTCTTTACAGGAAGCTTGGTCAAGAAACATTA
GXTGCTCCAAATATTGGCCTTGAAGCTGGAGGACTTGAAGCTGCCGAACAATATTGTGCAGAAATTGGTAGACCAGATGCCTACATGCAA
CTGCTTGAGATGTATTTGGATCCGAAGGATGGCAAAGAGCCCATGTTTAAGGCTGCTGTCCGCCTTCTCCACAATCATGGAGAAGCACTT
GACCCTTTACAAGTCTTGGAGAGGTTGTCCCCTGACATGCCCCTCCAGCTTGCTTCAGATACTATATTGAGAATGCTGAGGGCACGGCTT
CATCATCATCGGCAAGGGCAAATTGTCCATAATCTATCCCGTGCTTTAGATGTCGATGCGAGCTTGGCACGATTGGAGGAAAGGTCACGC
CACGTGCTGATCAATGATGAGAGTGTTTGTGATTCTTGTCATGCTCGGCTTGGAACCAAATTATTTGCAATGTACCCAGATGACACAATT
GCTGCTATAAGTGTTTTCGTCGTCAAGGTGAATCCACCTCTGTCACAGGXTCGTAATTTCGAGGAAGATGTTTTATATAAACCAGGCTGG
TTGGAACACGGTGACCATGGAAAAGCAGATGATCTTCTATGTCTTGAGCTGGCTGCATGGCATGATCAAGAACTCCGGTTGCATATGCAA
TTGCXX
Edits in Original Sequence 
(5')XGCCCAGAAGAGGTCCTTGACTTGATTGAAGGATCCGAATTGTGGCTGGAAAAGGCTATTCTTTACAGGAAGCTTGGTCAAGAAAC
ATTAGXTGCTCCAAATATTGGCCTTGAAGCTGGAGGACTgTGAAGCTGCCGAACAATATTGTGCAGAAATTGGTAGACCAGATGCCTACA
TGCAACTGCTTGAGATGTATTTGGATCCGAAGGATGGCAAAGAGCCCATGTTTAAGGCTGCTGTCCGCCTTCTCCACAATCATGGAGAAG
CACTTGACCCTTTACAAGTCTTGGAGAGGTTGTCCCCTGACATGCCCCTCCAGCTTGCTTCAGATACTATATTGAGAATGCTGAGGGCAC
GGCTTCATCATCATCGGCAAGGGCAAATTGTCCATAATCTATCCCGTGCTTTAGATGTCGATGCGAGCTTGGCACGATTGGAGGAAAGGT
CACGCCACGTGCTGATCAATGATGAGAGTGTTTGTGATTCTTGTCATGCTCGGCTTGGAACCAAATTATTTGCAATGTACCCAGATGACA
CAATTGtCTGCTATAAGTGTTTTCGTCGTCAAGGTGAATCCACCTCTGTCACAGGXTCGTAATTTCGAGGAAGATGTTTTATATAAACCA
GGCTGGTTGGtAACACGGTGACCATGGAAAAGCAGATGATCTTCTATGTCTTGAGCTGGCTGCATGGCATGATCAAGAACTCCGGTTGCA
TATGCAATTGCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan