ESTScan Details for Unigene SGN-U629365

Score 
9
Direction 
Forward
Predicted Peptide Sequence 
GRGSQIESIRMRASLSVGLYIFIYILPSPQVSAYAASAKVQAPREHKLTTLLLIKSPQFSNQQKQESMNAEVISSGHLQLFPTSSNQDIV
APSFHLAAGPVPEHSIKAKKKTWAAQKTARAAVYAPTQTQAETFYDMLGISETGSISDIKKAYKQLARKYHPDVSPADRTEEYTKRFIEV
QEAYETLSDPQTRALYDMNLGRGLHFAFSTGRRNERMDDVEEWKLRWQSQLDELRLWSMHRDNVSSAVSGKAAASPSSSWGSRMRRKRTD
IYDLGFXVAYILPIASYKLGPFIVGILAPSLT*
Predicted Coding Sequence 
GGCCGGGGAAGCCAAATTGAATCTATCCGAATGCGAGCCTCTCTGTCTGTCGGTCTATATATATTCATATATATATTGCCGTCTCCACAA
GTCTCCGCATACGCTGCAAGTGCAAAAGTGCAAGCTCCAAGAGAACACAAATTAACTACACTACTACTGATTAAAAGCCCGCAATTCAGC
AACCAACAAAAGCAAGAAAGCATGAACGCCGAGGTTATTTCCAGCGGTCACCTGCAACTTTTCCCAACAAGTTCAAATCAAGACATTGTG
GCTCCCAGCTTCCATTTAGCGGCAGGGCCAGTACCGGAGCATAGCATTAAAGCCAAGAAGAAGACCTGGGCCGCTCAGAAAACTGCCAGG
GCCGCCGTTTATGCACCGACCCAGACCCAGGCCGAAACTTTCTATGATATGCTGGGAATTTCGGAAACAGGGTCGATTTCCGATATCAAG
AAAGCCTACAAACAGTTAGCAAGAAAATACCACCCTGACGTGTCACCGGCGGACCGCACGGAAGAGTACACCAAGAGGTTTATCGAGGTT
CAGGAAGCTTACGAGACGCTTTCTGATCCACAGACTAGAGCTTTGTACGATATGAATTTAGGTCGAGGATTGCATTTCGCTTTTTCAACC
GGAAGACGCAACGAGAGAATGGATGATGTGGAGGAATGGAAACTTAGGTGGCAATCTCAACTGGATGAGCTGAGGCTGTGGAGCATGCAC
AGGGATAATGTCTCCTCCGCCGTTAGTGGGAAGGCAGCGGCGTCGCCCTCGTCGTCCTGGGGTAGTCGAATGCGCCGAAAGAGAACTGAC
ATTTATGATCTTGGATTTAXGGTAGCATATATTTTGCCTATTGCTAGCTATAAGCTAGGTCCGTTCATCGTGGGGATCCTTGCTCCCTCT
CTGACATAA
Edits in Original Sequence 
(5')GGCCGGGGAAGCCAAATTGAATCTATCCGAATGCGAGCCTCTCTGTCTGTCGGTCTATATATATTCATATATATATTGCCGTCTCC
ACAAGTCTCCGCATAgCGCTGCAAGTGCAAAAGTGCAAGCTCCAAGAGAACACAAATTAACTACACTACTACTGATTAAAAGCCCGCAAT
TCAGCAACCAACAAAAGCAAGAAAGCATGAACGCCGAGGTTATTTCCAGCGGTCACCTGCAACTTTTCCCAACAAGTTCAAATaCAAGAC
ATTGTGGCTCCCAGCTTCCATTTAGCGGCAGGGCCAGTACCGGtAGCATAGCATTAAAGCCAAGAAGAAGACCTGGGCCGCTCAGAAtAA
CTGCCAGGGCCGCCGTTTATGCACCGACCCAGACCCAGGCCGAAACTTTCTATGATATGCTGGGAATTTCGGAAACAGGGTCGATTTCCG
ATATCAAGAAAGCCTACAAACAGTTAGCAAGAAAATACCACCCTGACGTGTCACCGGCGGACCGCACGGAAGAGTACACCAAGAGGTTTA
TCGAGGTTCAGGAAGCTTACGAGACGCTTTCTGATCCACAGACTAGAGCTTTGTACGATATGAATTTAGGTCGAGGATTGCATTTCGCTT
TTTCAACCGGAAGACGCAACGAGAGAATGGATGATGTGGAGGAATGGAAACTTAGGTGGCAATCTCAACTGGATGAGCTGAGGCTGTGGA
GCATGCACAGGGATAATGTCTCCTCCGCCGTTAGTGGGAAGGCAGCGGCGTCGCCCTCGTCGTCCTGGGGTAGTCGAATGCGCCGAAAGA
GAACTGACATTTATGATCTTGGATTTAXGGTAGCATATATTTTGCCTATTGCTAGCTATAAGCTAGGTCCGTTCATCGTGGGGATCCTTG
CTCCCTCTCTGACATAA(3')TCATGACAGATTTCGCCGCCGCCGCCGGCAGCACTGGGAGCTGTATCCAGATGTATATAATTAATTTTT
TCTCTCTTCCATTTGGACGTGTTTATAACTCGGCCATATCGTTTTGGCTTCTAGAATTATTGGGAAAAATAAATATTTCCCTTTTTTTTG
TGGATAAGATTCTAACTTCTATTAATGCACTACTGCCTTTTAATTAATGAAATGGGTTCTTTGATCCAATTGAGAAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan