ESTScan Details for Unigene SGN-U629638

Score 
433
Direction 
Forward
Predicted Peptide Sequence 
GRGEENHCYENQMSHVLPPQEVAYDSLENSVERLCLSFCDPVHNLEDLVRSDVYSNVIQPATIHSFPGLPPPPPDHTLLSDGKHPTQPSG
LYVSLSVSLGVLATTFLIFSIYMIYKFYKRRYTSSRSRQLIPQPQQQPREDEEAHLDFLDEDQGPVVDHPIWYIRTVGLQPSVINAITIC
KYKRGDGLVEGTECSVCLNEFQEDETXKAAAQXVIMLFIYLALILGSDHTPIAPIAXAGIVVSTANLQSSSQSHHNSGRVEEIQMGVSEN
NRDSERERERESEVLEVGVEAEQENESRVGTGNAX
Predicted Coding Sequence 
GGCCGGGGGGAAGAAAATCACTGTTATGAAAATCAAATGAGCCATGTCCTTCCACCACAGGAAGTTGCTTATGATTCTCTCGAGAATTCA
GTTGAAAGACTTTGTCTATCTTTCTGTGATCCTGTACACAACCTAGAGGATCTTGTCCGGTCAGATGTATACTCCAATGTTATCCAACCT
GCAACGATCCACTCTTTCCCXGGTCTGCCTCCACCACCTCCTGATCATACTTTGCTTTCTGATGGCAAGCATCCTACCCAGCCATCTGGA
CTCTATGTCTCCCTCTCCGTGTCTCTTGGTGTTTTAGCCACAACTTTCTTGATTTTCTCTATCTACATGATATACAAGTTTTATAAACGT
CGGTATACGTCTTCAAGGAGTAGGCAATTGATTCCACAGCCCCAGCAGCAGCCTCGAGAGGATGAAGAAGCCCATCTGGATTTTCTTGAT
GAAGATCAGGGTCCCGTGGTTGACCATCCCATATGGTATATCAGGACAGTTGGTCTTCAGCCGTCTGTGATTAATGCAATCACTATTTGT
AAGTATAAAAGAGGTGATGGACTGGTGGAAGGAACAGAGTGCTCTGTTTGCTTGAATGAATTTCAAGAAGATGAGACTXTTAAGGCTGCT
GCCCAAGXTGTAATCATGCTTTTCATATACCTTGCATTGATACTTGGCTCAGATCACACACCAATTGCCCCAATTGCCGXAGCTGGGATT
GTTGTGAGCACGGCTAACCTCCAGTCTTCGTCGCAGAGTCATCATAATTCAGGTCGTGTGGAGGAAATCCAAATGGGAGTTTCGGAAAAT
AATAGGGATTCCGAGAGAGAAAGGGAAAGGGAAAGTGAGGTTCTTGAAGTCGGTGTTGAAGCGGAACAAGAAAATGAATCAAGGGTAGGA
ACCGGAAATGCATXX
Edits in Original Sequence 
(5')GGCCGGGGGGAAGAAAATCACTGTTATGAAAATCAAATGAGCCATGTCCTTCCACCACAGGAAGTTGCTTaATGATTCTCTCGAGA
ATTCAGTTGAAAGACTTTGTCTATCTTTCTGTGATCCTGTACACAACCTAGAcGGATCTTGTCCGGTCAGATGTATACTCCAATGTTATC
CAACCTGCAACGATCCACTCTTTCCCXGGTCTGCCTCCACCACCTCCTGATCATACTTTGCTTTCTGATGGCAAGCATCCTACCCAGCCA
TCTGGACTCTATGTCTCCCTCTCCGTGTCTCTTGGTGTTTTAGCCACAACTTTCTTGATTTTCTCTATCTACATGATATACAAGTTTTAT
AAACGTCGGTATACGTCTTCAAGGAGTAGGCAATTGATTCCACAGCCCCAGCAGCAGCCTCGAGAGGATGAAGAAGCCCATCTGGATTTT
CTTGATGAAGATCAGGGTCCCGTGGTTGACCATCCCATATGGTATATCAGGACAGTTGGTCTTCAGCCGTCTGTGATTAATGCAATCACT
ATTTGTAAGTATAAAAGAGGTGATGGACTGGTGGAAGGAACAGAGTGCTCTGTTTGCTTGAATGAATTTCAAGAAGATGAGACTXTTAAG
GCTGCTGCCCAAGXTGTAATCATGCTTTTCATATACCTTGCATTGATACTTGGCTCAGATCACACACCAATTGCCCCAATTGCCGXAGCT
GGGATTGTTGTGAGCACGGCTAACCTCCAGTCTTCGTCGCAGAGTCATCATAATTCAGGTCGTGTGGAGGAAATCCAAATGGGAGTTTCG
GAAAATAATAGGGATTCCGAGAGAGAAAGGGAAAGGGAAAGTGAGGTTCTTGAAGTCGGTGTTGAAGCGGAACAAGAAAATGAATCAAGG
GTAGGAACCGGAAATGCATXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan