ESTScan Details for Unigene SGN-U629971

Score 
397
Direction 
Forward
Predicted Peptide Sequence 
MGLAISRFAKMLFAKKEMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNASFTVWDVGGQDKIRPLWRHYFQNTQGLIF
VVDSNDKERISEARDELHRMLNEEELRDAILLVFANKQDLPNAMRVSEITDKLGLHSLRRAAGISRVPAATSGQGLYEGLDWLSSNXLKQ
GITAEAVNLAPPELISLRLTGNESQIPAKKFRMQNGHEQVKAPHFASSKCNAEGXDTVCEMASSSVPIFLFAFFAXDGNESLLSPCLNCF
FGTKGSTIIPXWLIPETSTNDDELSKRNGHTHLVX
Predicted Coding Sequence 
ATGGGTTTGGCAATATCAAGGTTTGCAAAAATGCTCTTTGCGAAGAAAGAAATGAGGATTCTGATGGTTGGTCTTGATGCCGCTGGCAAA
ACTACTATTCTGTACAAGTTAAAGCTTGGAGAGATTGTTACTACCATCCCCACTATAGGCTTCAATGTAGAGACAGTGGAATACAAAAAC
GCAAGTTTCACAGTATGGGATGTAGGAGGACAGGATAAGATTCGACCTTTATGGAGGCACTACTTTCAGAACACTCAGGGCCTTATTTTC
GTAGTTGATAGTAATGACAAAGAAAGAATTTCAGAAGCAAGAGATGAGCTCCATCGAATGCTTAATGAGGAGGAACTACGTGATGCCATC
CTTCTTGTCTTTGCCAATAAGCAAGATCTCCCAAATGCCATGAGAGTCTCTGAAATCACAGATAAACTTGGCCTCCACTCACTCCGTCGC
GCCGCTGGTATATCCAGAGTGCCTGCXGCAACTTCGGGTCAGGGACTCTACGAGGGCCTAGATTGGTTGTCTAGCAATXATCTCAAGCAA
GGCATAACTGCAGAAGCTGTCAACTTGGCGCCTCCAGAACTTATTTCCTTACGTCTGACAGGTAATGAATCACAAATTCCTGCAAAGAAA
TTTAGGATGCAGAACGGGCATGAGCAAGTGAAAGCCCCTCATTTTGCATCGAGTAAGTGTAATGCAGAAGGTXCTGATACTGTGTGCGAA
ATGGCATCTTCTTCTGTTCCTATTTTTCTTTTTGCCTTTTTTGCTGXTGATGGTAATGAATCACTTCTTAGCCCCTGCCTGAACTGTTTC
TTTGGAACTAAAGGTAGTACAATTATTCCAXCATGGTTGATTCCTGAAACTTCAACCAATGATGATGAACTCAGCAAGAGAAATGGGCAT
ACTCATTTAGTTCXX
Edits in Original Sequence 
CTTCTACTAAATTTTTCAAGTGAGTGAATTTGGACAGCTTAAAGTACGACGTACCTAATTTTCTTTTTCTAGTTTCCTGATTATTTGGTA
CAGAA
(5')ATGGGTTTGGCAATATCAAGGTTTGCAAAAATGCTCTTTGCGAAGAAAGAAATGAGGATTCTGATGGTTGGTCTTGATGCC
GCTGGCAAAACTACTATTCTGTACAAGTTAAAGCTTGGAGAGATTGTTACTACCATCCCCACTATAGGCTTCAATGTAGAGACAGTGGAA
TACAAAAACGCAAGTTTCACAGTATGGGATGTAGGAGGACAGGATAAGATTCGACCTTTATGGAGGCACTACTTTCAGAACACTCAGGGC
CTTATTTTCGTAGTTGATAGTAATGACAAAGAAAGAATTTCAGAAGCAAGAGATGAGCTCCATCGAATGCTTAATGAGGAGGAACTACGT
GATGCCATCCTTCTTGTCTTTGCCAATAAGCAAGATCTCCCAAATGCCATGAGAGTCTCTGAAATCACAGATAAACTTGGCCTCCACTCA
CTCCGTCaGCGCCGCTGGTATATCCAGAGTGCCTGCXGCAACTTCGGGTCAGGGACTCTACGAGGGCCTAGATTGGTTGTCTAGCAATXA
TCTCAAGCAAGGCATAACTGCAGAAGCTGTCAACTTGGCGCCTCCAGAACTTATTTCCTTACGTCTaGACAGGTAATGAATCACAAATTC
CTGCtAAAGAAATTTAGGATGCAGAACGGGCATGAGCAAGTGAAAGCCCCgTCATTTTGCATCGAGTAAGTGTAATGCAGAAGGTXCTGA
TACTGTGTGCGAAATGGCATCTTCTTCTGTTCCTATTTTTCTTTTTGCCTTTTTTGCTGXTGATGGTAATGAATCACTTCTTAGCCCCTG
CCTGAACTGTTTCTTTGGAACTAAAGGTAGTACAATTATTCCAXCATGGTTGATTCCTGtAAACTTCAACCAATGATGATGAACTCAGCA
AGAGAAATGGGCATACTCATTTAGTTCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan