Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U630070

Score 
50
Direction 
Forward
Predicted Peptide Sequence 
XAGGILKGGIKYDAPFARQREPAFIINTTTVLIPPQTLVSGSYVLSAPSSSFSILPISSTHQPLQSHPASFFNNSLQIINFXVAFPAHLA
VLFVAFTRVLSPIKILPKNHKIDFAMGLSPYSAPADGGVFCVILVNTAISISIVKEIFRSILQVVGIHIAAWEDYSVDNTLESLECRGSP
SDPIWRSSEAELQQFVMIQSIAAVAPAMSAQSAXTEFEPDAEINHLSWATYFIDYAGKVVEILACYMSSLPELYAXLKKGLKTLVLCEHN
XKTVETLSLLYSIAVYKQFTACSDPCFASFMVTGPCGQDLYCIFCQKLMLYAVELLX
Predicted Coding Sequence 
XXGGCCGGGGGGATCTTGAAGGGTGGCATAAAATATGATGCCCCATTTGCTCGGCAGCGTGAGCCAGCCTTTATTATCAACACAACCACT
GTCTTAATCCCTCCTCAGACGCTCGTCTCGGGATCCTATGTGCTATCAGCTCCCTCTTCCTCTTTCTCAATCCTTCCAATATCTTCTACT
CACCAACCCCTTCAGAGCCACCCTGCTTCTTTCTTTAACAATAGTCTCCAAATTATTAACTTTXCTGTAGCTTTTCCAGCTCACCTTGCT
GTTTTATTTGTCGCTTTTACTAGGGTTCTAAGTCCGATCAAGATTTTGCCTAAGAATCACAAGATTGATTTTGCCATGGGTCTTTCGCCT
TACTCAGCTCCAGCCGATGGAGGAGTGTTTTGTGTAATTTTAGTAAACACAGCCATATCAATCTCCATAGTCAAGGAGATATTTCGTTCA
ATCCTTCAGGTTGTTGGCATTCACATTGCAGCTTGGGAAGATTATTCCGTTGACAACACCTTGGAATCATTAGAATGTCGTGGAAGCCCC
TCTGATCCTATATGGAGGAGTTCCGAAGCAGAACTCCAGCAATTCGTTATGATTCAATCCATAGCTGCAGTCGCCCCCGCCATGAGTGCC
CAGTCTGCCXTGACAGAATTCGAGCCAGATGCAGAGATTAACCACCTTTCTTGGGCCACGTATTTCATAGACTATGCTGGAAAAGTGGTT
GAAATATTGGCATGTTACATGTCCTCTTTGCCGGAATTATATGCTXACCTCAAGAAGGGCTTGAAAACACTTGTCCTATGTGAGCATAAT
XACAAAACTGTTGAAACTCTGTCTTTGTTGTACAGCATAGCAGTGTACAAACAATTTACTGCTTGTAGTGACCCCTGTTTTGCGTCCTTC
ATGGTGACGGGTCCTTGTGGCCAAGATTTGTATTGTATATTCTGTCAAAAGCTTATGCTCTATGCGGTTGAGCTTCTGATX
Edits in Original Sequence 
(5')XXGGCCGGGGGGATCTTGAAGGGTGGCATAAAATATGAtTGCCCCATTTGCTCGGCAGCGTGAGCCAGCCTTTATTATCAACACAA
CCACTGTCTTAATCCCTCCTCAGACGCTCGTCTCGGGATCCTATGTGCTATCAGCTCCCTCTTCCTCTTTCTCAATCCTTCCAATATCTT
CTACTCACCAACCCCTTCAGAGCCACCCTGCTTCTTTCTTTAACAATAGTCTCCAAATTATTAACTTTXCTGTAGCTTTTCCAGCTCACC
TTGtCTGTTTTATTTGTCGCTTTTACTAGGGTTCTAAGTCCGATCAAGATTTTGCCTAAGAATCACAAGAtTTGATTTTGCCATGGGTCT
TTCGCCTTACTCAGCTCCAGCCGATGGAGGAGTGTTTTGTGTAATTTTAGTAAACACAGCCATATCAATCTCCATAGTCAAGGAGATATT
TCGTTCAATCCTTCAGGTTGTTGGCATTCACATTGCAGCTTGGGAAGATTATTCCGTTGACAACACCTTGGAATCATTAGAATGTCGTGG
AAGCCCCTCTGAgTCCTATATGGAGGAGTTCCGAAGCAGAACTCCAGCAATTCGTTATGATTCAATCCATAGCTGCAGTCGCCCCCGCCA
TGAGTGCCCAGTCTGCCXTGACAGAATTCGAGCCAGATGCAGAGATTAACCACCTTTCTTGcGGCCACGTATTTCATAGACTATGcCTGG
AAAAGTGGTTGAAATATTGGCATGTTACATGTCCTCTTTGCCGGAATTATATGCTXACCTCAAGAAGGGCTTGAAAACACTTGTCCTATG
TGAGCATAATXACAAAACTGTTGAAACTCTGTCTTTaGTTGTACAGCATAGCAGTGTACAAACAATTTACTGCTTGTAGTGACCCCTGTT
TTGCGTCCTTCATGGTGACGGGTCCTTGTGGCCAAGATTTGTATTGTATATTCTGTCAAAAGCTTATGCTCTATGCGGTTGAGCTTCTGA
TX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan