ESTScan Details for Unigene SGN-U630419

Score 
333
Direction 
Reverse
Predicted Peptide Sequence 
XNPQGEALAINGNRDLVVAITFLMPVFAHCMAKXPVAYHDEEEVSPNILMDKSKKKATXPDFSINAAKRFFQSETASSPLTPHISVLFSG
SLETDRYWIDDATDSKWILFAGCRLKHHVATLTNHALVTLSLKLLASVLKYESFPWDCIKSFCTDEGSILLAKASLRCTTLFKAETLPSG
CVLQQT
Predicted Coding Sequence 
XXAAATCCACAAGGAGAAGCTTTAGCAATAAATGGAAATCGTGATCTTGTAGTAGCAATAACTTTCCTGATGCCTGTATTTGCTCATTGT
ATGGCTAAAXCACCTGTTGCTTACCACGATGAAGAGGAAGTCTCACCAAACATCTTGATGGACAAATCGAAGAAGAAAGCTACTAXCCCT
GATTTCTCCATCAATGCAGCAAAGCGCTTTTTCCAATCTGAGACAGCCTCTTCACCATTAACCCCTCATATATCAGTCCTGTTCTCCGGT
TCCCTTGAAACAGATAGGTATTGGATAGATGATGCTACAGACTCTAAATGGATTCTTTTTGCTGGATGTAGGTTGAAGCATCACGTAGCA
ACCCTTACTAACCACGCGCTAGTTACTCTTTCCTTAAAGCTCCTAGCCTCAGTTCTCAAATATGAATCCTTTCCCTGGGACTGCATCAAG
AGCTTCTGCACAGATGAAGGCAGCATCCTCCTTGCTAAGGCTTCCTTGCGTTGCACAACCCTTTTCAAAGCTGAAACGCTGCCTTCCGGG
TGTGTTCTTCAGCAAACC
Edits in Original Sequence 
(5')XXAAATCCACAAGGAGAAGCTTTAGCAATAAATGGAAATCGTGATCTTGTAGTAGCAATAACTTTCCTGATGCCTGTATTTGCTCA
TTGTATGGCTAAAXCACCTGTTGCTTACCACGATGAAGAGGAAGTCTCACCAAACATCTTGATGGACAAATCGAAGAAGAAAGCTACTAX
CCCTGATTTCTCCATCAATGCAGCAAAGCGCTTTTTCCAATCTGAGACAGCCTCTTCACCATTAACCaCCTCATATATCAGTCCTGTTCT
CCGGTTCCCTTGAAACAGATAGGTATTGGATAGATGATGCTACAGACTCTAAATGGATTCTTTTTGCTGGATGTAGGTTGAAGCATCACG
TAGCAtACCCTTACTAACCACGCGCTAGTTACTCTTTCCTTAAAGCTCCTAGCCTCAGTTCTCAAATATGAATCCTTTCCCTGGGACTGC
ATCAAGAGCTTCTGCACAGATGAAGGCAGCATCCTCCTTGCTAAGGCTTCCTTGCGTTGCACAACCCTTTTCAAAGCTGAAACGCTGCCT
TCCGGGTGTGTTCTTCAGCAAACC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan