ESTScan Details for Unigene SGN-U630434

Score 
665
Direction 
Forward
Predicted Peptide Sequence 
LQARLNRVKQNAGEKSKEKPAESQXQLVCSTFELPRILQNHDGGSLGFLLRYLVNISANLPHHFRKSYASVSALSMAKAKFQLPKQRKFS
TGHRNPSFSWMATVGENVQSNASAAAPPPTSVPVRVAHELLQAGHRYLDVRTAEEFSAGHAAGAVNVPYMFRVGSGMIKNLNFVEEVLAI
FGKDDEIIVGCQLGKRSLMAATDLISAGFTGITDIAGGYAAWVQNELPDRVVMTMEEGNTGCDA*
Predicted Coding Sequence 
CTCCAAGCTAGACTAAACAGAGTAAAACAAAACGCTGGTGAAAAGAGCAAAGAAAAACCAGCAGAGTCACAAGAXCAGCTAGTTTGTTCA
ACATTTGAACTTCCTCGTATACTTCAAAACCATGATGGGGGCTCTCTCGGTTTCCTCCTCCGCTACCTTGTCAACATTTCTGCTAATCTT
CCGCACCATTTCAGGAAAAGCTATGCATCAGTCTCAGCGCTATCAATGGCCAAGGCTAAGTTTCAACTCCCGAAACAACGCAAGTTCAGC
ACTGGCCACAGAAATCCCAGCTTCAGTTGGATGGCTACTGTTGGAGAGAATGTTCAATCAAATGCATCAGCAGCAGCACCACCACCAACA
TCAGTCCCGGTTCGTGTAGCTCACGAGCTGCTTCAGGCAGGCCATCGTTATTTAGATGTCAGGACTGCTGAAGAATTCAGTGCTGGTCAT
GCTGCTGGGGCTGTCAATGTGCCTTACATGTTTAGAGTTGGATCAGGTATGATTAAAAACCTGAACTTCGTGGAGGAAGTTTTAGCAATT
TTTGGGAAAGATGACGAAATTATTGTTGGCTGCCAATTGGGGAAAAGGTCATTGATGGCTGCAACTGATCTTATATCCGCTGGGTTTACT
GGCATTACAGACATTGCAGGTGGATATGCTGCCTGGGTACAGAATGAACTTCCXGACAGAGTCGTGATGACTATGGAGGAGGGGAACACG
GGTTGTGACGCTTAA
Edits in Original Sequence 
(5')CTCCAAGCTAGACTAAACAGAGTAAAACAAAACGCTGGTGAAAAGAGCAAAGAAAAACCAGCAGAGTCACAAGAXCAGCTAGTTTG
TTCAACATTTGAACTTCCTCGTATACTTCAAAACCATGATGGGGGCTCTCTCGGTTTCCTCCTCCGCTACCTTGTCAACATTTCTGCgTA
ATCTTCCGCACCATTTCAGGAAAAGCTATGCATCAGTCTCAGCGCTATCAATGGCCAAGGCTAAGTTTCAACTCCCGAAACAACGCAAGT
TCAGCACTGGCCACAGAAATCCCAGCTTCAGTTGGATGGCTACTGTTGGAGAGAATGTTCAATCAAATGCATCAGCAGCAGCACCACCAC
CAACATCAGTCCCGGTTCGTGTAGCTCACGAGCTGCTTCAGGCAGGCCATCGTTATTTAGATGTCAGGACTGCTGAAGAATTCAGTGCTG
GTCATGCTGCTGGGGCTGTCAATGTGCCTTACATGTTTAGAGTTGGATCAGGTATGATTAAAAACCTGAACTTCGTGGAGGAAGTTTTAG
CAATTTTTGGGAAAGATGACGAAATTATTGTTGGCTGCCAATTGGGGAAAAGGTCATTGATGGCTGCAACTGATCTTATATCCGCTGGGT
TTACTGGCATTACAGACATTGCAGGTGGATATGCTGCCTGGGTACAGAATGAACTTCCXGACAGAGTCGTGATGACTATGGAGGAGGGGA
ACACGGGTTGTGACGCTTAA(3')TAACACAGGCTATGTACAGCGTTAGATTATGCAAAATAATTTTTTTAAAAAATAAAAAATAAAAAA
TAAAAACTGGCTGTGTACTGACTTTACAAGCAGGGAGAAAAGGCAATGTCAAACAATTAAAACGGAAGTTGTACAGCAATAGGATTCCGA
AGCTATAGACATCTCCATTACTTGATACCACGGCACCTAAGCCATACTCTGCATTAATGTTGAAGCTTGTCAGACAGCCAAAGTTTGAAT
TGTCAAAATAGCTCAGTTTTAAAATTTGTTGTTTTGTGTATGAAAATAGGAAAAAACATATGATGTTGAATGAACATAGGTAAAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan