ESTScan Details for Unigene SGN-U630800

Score 
489
Direction 
Forward
Predicted Peptide Sequence 
RQIPVVSSREIDQIPAIFPPSQPXMNPEYDYLFKLLLIGDSGVGKSCLLLRFADDSYSESYISTIGVDFKIRTVEQDGKTIKLQIWDTAG
QERFRTITSSYYRGAHGIIVVYDVTDQESFNNVKQWLNEIDRYASENVNKILVGNKSDLTDKKVVSYETAKAFADEIGIPFLETSAKDAT
NVEQAFMAMSAAIKNRMASQPAMNNAKPPTVNMRGQPVAQKVAAARHEHNGQTTSGSLTLLLHVKALYEDQLNQKTLDSLLSFPTLFFSE
RLFHVLIDKFIVVDDRTIGCIRCCPVDACQPIASQIYVNLLA
Predicted Coding Sequence 
CGTCAGATACCGGTCGTTTCTAGCCGGGAAATCGATCAGATTCCGGCAATCTTCCCTCCTAGTCAACCTXCAATGAATCCGGAATATGAT
TATTTGTTCAAACTGTTGCTTATTGGAGATTCTGGTGTTGGAAAATCATGTCTTCTTCTGAGATTTGCGGATGATTCATATTCGGAAAGT
TATATAAGCACCATTGGAGTTGATTTTAAAATACGTACTGTGGAACAAGATGGAAAGACTATTAAACTTCAAATTTGGGACACTGCTGGA
CAAGAACGTTTTAGGACCATCACTAGCAGTTACTATCGTGGAGCACATGGTATCATTGTGGTTTATGATGTGACAGATCAAGAAAGTTTC
AACAATGTTAAGCAGTGGCTTAATGAAATTGATCGCTATGCAAGTGAAAATGTTAATAAAATTCTAGTTGGAAATAAGTCCGATCTCACT
GATAAGAAAGTTGTTTCCTATGAGACGGCTAAGGCATTTGCTGATGAAATTGGTATTCCATTTTTGGAAACTAGTGCTAAAGATGCTACT
AATGTGGAGCAAGCTTTCATGGCGATGTCTGCTGCCATAAAGAATAGGATGGCAAGCCAACCAGCCATGAACAATGCTAAGCCTCCCACA
GTTAATATGCGTGGGCAGCCTGTTGCACAGAAAGTGGCTGCTGCTCGTCATGAACACAATGGACAAACAACTTCTGGATCATTGACTCTA
CTGCTGCATGTGAAAGCCCTTTATGAAGACCAACTTAATCAAAAGACACTTGATAGTTTATTATCTTTTCCGACTTTATTCTTTTCTGAA
CGTTTGTTTCATGTACTGATTGACAAATTTATTGTAGTGGATGATAGAACAATTGGTTGTATTCGCTGTTGTCCTGTAGATGCTTGCCAG
CCCATTGCTAGCCAAATATATGTTAATTTGCTTGCG
Edits in Original Sequence 
GGCCGGGGGATCTGCGTTTACTTTGAAAGCTCCTCTTCAACGACCACCCTTCTCTCTCTCTCTCTCTCTCTCTCTCTCTCTGCATTTCTT
TAAATTACATCCGAATTAGCCGACAGATAGT
(5')CGTCAGATACCGGTCGTTTCTAGCCGGGAAATCGATCAGATTCCGGCAATCTTCC
CTCCTAGTCAACCTXCAATGAATCCGGAATATGATTATTTGTTCAAACTGTTGCTTATTGGAGATTCTGGTGTTGGAAAATCATGTCTTC
TTCTGAGATTTGCGGATGATTCATATTCGGAAAGTTATATAAGCACCATTGGAGTTGATTTTAAAATACGTACTGTGGAACAAGATGGAA
AGACTATTAAACTTCAAATTTGGGACACTGCTGGACAAGAACGTTTTAGGACCATCACTAGCAGTTACTATCGTGGAGCACATGGTATCA
TTGTGGTTTATGATGTGACAGATCAAGAAAGTTTCAACAATGTTAAGCAGTGGCTTAATGAAATTGATCGCTATGCAAGTGAAAATGTTA
ATAAAATTCTAGTTGGAAATAAGTCCGATCTCACTGATAAGAAAGTTGTTTCCTATGAGACGGCTAAGGCATTTGCTGATGAAATTGGTA
TTCCATTTTTGGAAACTAGTGCTAAAGATGCTACTAATGTGGAGCAAGCTTTCATGGCGATGTCTGCTGCCATAAAGAATAGGATGGCAA
GCCAACCAGCCATGAACAATGCTAAGCCTCCCACAGTTAATATGCGTGGGCAGCCTGTTGCACAGAAtAGTGGCTGCTGCTCGTCATGAA
CACAATGGACAAACAACTTCTGGATCATTGACTCTACTGCTGCATGTGAAAGCaCCTTTATGAAGACCAACTTAATCAAAAGACACTTGA
TAGTTTATTATCTTTTCCGACTTTATTCTTTTCTGAACGTTTGTTTCATGTACTGATTGtACAAATTTATTGTAGTGGATGATAGAACAA
TTGGTTGTATTCGCTGTTGTCCTGTAGATGCTTGCCAGCCCATaTGCTAGCCAAATATATGTTAATTTGCTTGCG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan