ESTScan Details for Unigene SGN-U631212

Score 
729
Direction 
Forward
Predicted Peptide Sequence 
XKYEDKNRQKYXALGGMALALFEALDAVEVPARDPKGPFRMPIIDKFKDMGTVVMGKVESGSIREGDNLLVMPNKAQVKVVAIFCDEDKA
RRAGPGENLRVRISRVEEEEVLAGFVLSSVAKPIPAVSEFVAQLQILELLDNAIFTAGYKAVLHIHAIVEECEIVELMQQIDPKTKKPMK
KKPLFVKNGAVVVCRIQVNNLMCVEKFSDFPQLGRFTLRTEGKTVAVGKVTSLPSIGDVLKTILTWAWLRXVKFEHTSGQQNEVFTYYGI
SVADVEEGSFMARXIVRLVILVWNLNRFSTLVDAPVYNGWLSLHSAVIGVFM*
Predicted Coding Sequence 
XXCAAATATGAAGACAAGAATAGACAAAAGTATXATGCCCTTGGTGGAATGGCCCTTGCXCTTTTTGAAGCTCTTGATGCTGTTGAAGTT
CCTGCACGCGATCCCAAAGGTCCATTTAGAATGCCTATTATTGACAAATTCAAAGACATGGGAACGGTGGTAATGGGCAAAGTTGAATCT
GGTAGCATCCGTGAAGGGGATAATTTGTTGGTCATGCCAAACAAGGCTCAGGTGAAAGTTGTTGCCATCTTCTGTGATGAAGATAAAGCT
AGGCGTGCTGGACCTGGTGAAAATTTGCGGGTGAGGATATCACGGGTTGAGGAAGAGGAAGTGTTAGCAGGGTTTGTTTTGAGCAGCGTT
GCCAAGCCAATACCTGCTGTATCTGAGTTTGTCGCGCAGCTACAGATTTTGGAATTGCTGGATAATGCTATTTTTACTGCTGGTTACAAG
GCTGTATTGCATATTCATGCTATTGTTGAGGAATGTGAAATTGTTGAACTAATGCAGCAGATTGACCCGAAGACAAAAAAGCCAATGAAG
AAGAAACCTCTTTTTGTAAAGAATGGTGCTGTTGTCGTTTGTCGTATCCAGGTGAATAATTTGATGTGTGTTGAGAAATTCTCTGATTTT
CCACAGCTTGGACGCTTCACTCTTCGAACTGAAGGGAAAACTGTTGCTGTGGGAAAAGTTACTAGCCTTCCATCCATAGGCGATGTGCTT
AAAACAATTTTGACATGGGCTTGGCTTCGAGXTGTAAAATTTGAACATACTAGTGGGCAGCAGAATGAGGTTTTTACCTATTATGGTATC
TCGGTTGCAGATGTGGAAGAAGGTTCATTCATGGCTCGTGAXATCGTGAGACTTGTTATTTTAGTCTGGAATCTGAATAGATTTTCGACT
CTTGTGGATGCTCCCGTCTACAATGGTTGGTTGTCATTGCATTCAGCTGTCATTGGGGTATTTATGTGA
Edits in Original Sequence 
(5')XXCAAATATGAAGACAAGAATAGACAAAAGTATXATGCCCTTGGTGGAATGGCCCTTGCXCTTTTTGAAGCTCTTGATGCTGTTGA
AGTTCCTGCACGCGATCCCAAAGGTCCATTTAGAATGCCTATTATTGACAAATTCAAAGACATGGGAACGGTGGTAATGGGCAAAGTTGA
ATCTGGTAGCATCCGTGAAGGGGATAATTTGTTGGTCATGCCAAACAAGGCTCAGGTGAAAGTTGTTGCCATCTTCTGTGATGAAGATAA
AGCTAGGCGTGCTGGACCTGGTGAAAATTTGCGGGTGAGGATATCACGGGTTGAGGAAGAGGAAGTGTTAGCAGGGTTTGTTTTGAGCAG
CGTTGCCAAGCCAATACCTGCTGTATCTGAGTTTGTCGCGCAGCTACAGATTTTGGAATTGCTGGATAATGCTATTTTTACTGCTGGTTA
CAAGGCTGTATTGCATATTCATGCTATTGTTGAGGAATGTGAAATTGTTGAACTAATGCAGCAGATTGACCCGAAGACAAAAAAGCCAAT
GAAGAAGAAACCTCTTTTTGTAAAGAATGGTGCTGTTGTCGTTTGTCGTATCCAGGTGAATAATTTGATGTGTGTTGAGAAATTCTCTGA
TTTTCCACAGCTTGGACGCTTCACTCTTCGAACTGAAGGGAAAACTGTTGCTGTGGGAAAAGTTACTAGCCTTCCATCCATAGGCGATcG
TGCTTAAAACAATTTTGACATGaGGCTTGGCTTCGAGXTGTAAAATTTGAACATACTAGTGcGGCAGCAGAATGAGGTTTTTACCTATTA
TGGTATCTCGGTTGCAGATGTGGAAGAAGGTTCATTCgATGGCTCGTGAXATCGTGAGACTTGTTATTTTAGTCTGGAATCTGAATAGAT
TTTCGACTCTTGTGGATGCTCCCGTCTACAATGGTTGGTTGTCATTGCATTCAGCTGTCATTGGGGTATTTATGTGA(3')AACATAATA
GAGAGTTTTGTATCTGTATTCGAAGTAAACCTCTGCATTTACTCATAACGATTGGTTTTGATGGTAGGTTATACCGAGTAGAGCATGCCT
TTATATCATGGTCAGTTTTTGGACCAAATATTTTTCTGTTCACGAGATTAAAGTTTATATTTAACACAGTCAG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan