ESTScan Details for Unigene SGN-U631241

Score 
1078
Direction 
Forward
Predicted Peptide Sequence 
MVFLESTEAQILGVAIAAVAVGAAAFYLYSSKKAKVCLDPEKWKEFKLVKRTQLSHNVAKFRFTLPTPTSVLGLPIGQHISCRGKDGQGE
EVIKPYTPTTLDSDVGYFELVIKMYPQGRMSHHFRELRVGDYLAVKGPKGRFRYQPGQVRAFGMLAGGSGITPMFQVARAILENPNDKTN
VHLIYANVTYEDILLKEELESLTANYAGRFKVYYVLNQPPEVWNGGVGFVSKEMIQEHCPAPASDIKVLRCGPPPMNKAMAAHLEALGYT
PEMQFQF*
Predicted Coding Sequence 
ATGGTTTTCTTGGAATCAACGGAAGCCCAGATCCTTGGCGTTGCTATAGCTGCTGTTGCTGTTGGTGCTGCTGCTTTTTACTTGTATTCT
TCCAAGAAAGCTAAAGTGTGCTTAGATCCTGAGAAATGGAAGGAATTCAAGCTTGTGAAGCGCACACAGCTGAGCCATAATGTGGCAAAG
TTCAGATTTACACTTCCCACGCCCACCTCCGTGTTGGGACTTCCCATTGGACAGCATATAAGTTGCAGGGGTAAGGATGGTCAAGGGGAA
GAGGTCATAAAACCATATACTCCAACCACATTGGACTCGGATGTTGGATACTTTGAATTAGTTATAAAGATGTATCCTCAAGGAAGGATG
TCTCACCATTTCCGTGAACTGCGTGTTGGAGATTATTTGGCTGTTAAAGGACCCAAGGGTCGTTTTAGATATCAACCGGGACAAGTTAGA
GCATTTGGAATGCTTGCTGGAGGCTCTGGCATCACCCCAATGTTTCAGGTTGCCAGAGCTATTTTAGAAAACCCAAATGACAAAACAAAT
GTACATCTCATCTATGCTAATGTTACCTATGAGGACATTCTTTTGAAGGAAGAGTTGGAGTCTTTGACTGCTAATTATGCTGGCCGTTTC
AAAGTTTACTATGTCCTCAATCAGCCTCCAGAAGTATGGAATGGTGGTGTTGGCTTCGTCTCTAAGGAAATGATTCAAGAGCATTGCCCT
GCACCTGCATCTGACATTAAGGTATTGAGATGTGGACCTCCACCAATGAACAAGGCTATGGCAGCTCATCTTGAAGCTCTTGGTTACACC
CCAGAGATGCAATTCCAATTTTAA
Edits in Original Sequence 
CCGGGGGAAGAACATATTTATATATGTAAATAGATCAATTTTTTGTTGACATTTCCATCCCACGAAGTTCAAAAAATCATATTTGGTCTA
TTGGGTGTGCCAAG
(5')ATGGTTTTCTTGGAATCAACGGAAGCCCAGATCCTTGGCGTTGCTATAGCTGCTGTTGCTGTTGGTGCTGCT
GCTTTTTACTTGTATTCTTCCAAGAAAGCTAAAGTGTGCTTAGATCCTGAGAAATGGAAGGAATTCAAGCTTGTGAAGCGCACACAGCTG
AGCCATAATGTGGCAAAGTTCAGATTTACACTTCCCACGCCCACCTCCGTGTTGGGACTTCCCATTGGACAGCATATAAGTTGCAGGGGT
AAGGATGGTCAAGGGGAAGAGGTCATAAAACCATATACTCCAACCACATTGGACTCGGATGTTGGATACTTTGAATTAGTTATAAAGATG
TATCCTCAAGGAAGGATGTCTCACCATTTCCGTGAACTGCGTGTTGGAGATTATTTGGCTGTTAAAGGACCCAAGGGTCGTTTTAGATAT
CAACCGGGACAAGTTAGAGCATTTGGAATGCTTGCTGGAGGCTCTGGCATCACCCCAATGTTTCAGGTTGCCAGAGCTATTTTAGAAAAC
CCAAATGACAAAACAAATGTACATCTCATCTATGCTAATGTTACCTATGAGGACATTCTTTTGAAGGAAGAGTTGGAGTCTTTGACTGCT
AATTATGCTGGCCGTTTCAAAGTTTACTATGTCCTCAATCAGCCTCCAGAAGTATGGAATGGTGGTGTTGGCTTCGTCTCTAAGGAAATG
ATTCAAGAGCATTGCCCTGCACCTGCATCTGACATTAAGGTATTGAGATGTGGACCTCCACCAATGAACAAGGCTATGGCAGCTCATCTT
GAAGCTCTTGGTTACACCCCAGAGATGCAATTCCAATTTTAA(3')TTTTGTCACAAATTTAGCCCTACACATGGTTTCATTGTTAGTGT
GGGGGGAACAGAATTTTTCATGTTGGAATAGCAGGGGAAATGAATCATGTAATGCAAATTGTTGACGTTGTTCCTGTGAACTTGGAGCAA
TAAAATTTCCCAGAAGTTTATGACTGTCTTTGAATTGCGTAGAC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan