Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U631300

Score 
357
Direction 
Forward
Predicted Peptide Sequence 
XAGGRQNNPXLRPKEERLLQSLFSARAVHFFFSRFTCGIKAMKQKVVIRLSMNDEKXPQEAFKTVVGHAGVESTALQGKEKDQIEVVGDG
IDAVKLATLLRKNVGYAELVTVSPVGEKKDGDKKEDGKKDPSSTEPPVVWSTHPYVYSSYLTISIKLETPMMTPTAPSCKNAGHKKFGNF
RVTIFFPVIQGKVKFRGAAKFWHGPLENWNEDENSIIEGEGKILGSVGGGXLFLGANKPVGAIA*
Predicted Coding Sequence 
XXGGCCGGGGGACGGCAGAATAACCCAXTTCTAAGGCCGAAAGAAGAACGACTTCTGCAGTCTCTTTTCTCAGCTAGAGCTGTTCATTTT
TTTTTCAGTCGTTTTACTTGCGGAATTAAGGCAATGAAGCAAAAAGTCGTGATTAGACTTTCTATGAATGATGAGAAGXTCCCGCAAGAA
GCCTTCAAAACTGTTGTCGGTCACGCAGGTGTGGAATCTACGGCTTTGCAGGGAAAGGAAAAGGATCAAATAGAGGTTGTTGGAGATGGG
ATTGATGCAGTGAAGCTTGCAACTTTGCTCAGAAAAAATGTTGGGTATGCAGAGCTTGTGACCGTGAGCCCAGTTGGTGAGAAGAAAGAT
GGTGATAAAAAAGAAGATGGCAAGAAAGATCCCAGTTCTACGGAGCCACCTGTGGTTTGGTCCACTCATCCTTATGTTTACAGCAGCTAC
CTCACCATCTCTATCAAGTTAGAGACCCCTATGATGACTCCAACTGCACCATCATGTAAGAATGCAGGACACAAGAAATTTGGGAATTTT
AGGGTTACCATCTTTTTCCCAGTCATACAAGGAAAAGTGAAGTTCAGGGGTGCTGCTAAATTTTGGCATGGTCCTCTAGAGAACTGGAAT
GAAGATGAGAATTCAATCATAGAAGGTGAAGGGAAGATACTTGGGTCCGTAGGGGGAGGAXCTCTGTTTCTTGGTGCTAATAAACCAGTT
GGAGCTATTGCCTAG
Edits in Original Sequence 
(5')XXGGCCGGGGGACGGCAGAATAACCCAXTTCTAAGGCCGAAAGAAGAACGACTTCTGCAGTCTCTTTTCTCAGCTAGAGCTGTTCA
TTTTTTTTTCAGTCGTTTTACTTGCGGAATTAAGGCAATGAAGCAAAAAGTCGTGATTAGACTTTCTATGAATGATGAGAAGXTCCCGCA
AGAAgGCCTTCAAAACTGTTGTCGGTCACGCAGGTGTGGAATCTACGGCTTTGCAGGGAAAGGAAAAGGATCAAATAGAGGTTGTTGGAG
ATGGGATTGATGCAGTGAAGCTTGCAACTTTGCTCAGAAAAAATGTTGGGTATGCAGAGCTTGTGACCGTGAGCCCAGTTGGTGAGAAGA
AAGATGGTGATAAAAAAGAAGATGGCAAGAAAGATCCCAGTTCTACGGAGCCACCTGTGGTTTGGTCCACTCATCCTTATGTTTACAGCA
GCgTACCTCACCATCTCTATCAAGTTAGAGACCCCTATGATGACTCCAACTGCACCATCATGTAAGAATGCAGGACACAAGAAATTTGGG
AATTTTAGGGTTACCgATCTTTTTCCCAGTCATACAAGGAAAAGTGAAGTTCAGGGGTGCTGCTAAATTTTaGGCATGGTCCTCTAGAGA
ACTGGAATGAAGATGAGAATTCAATCATAGtAAGGTGAAGGGAAGATACTTGGGTCCGTAGGGGGAGGAXCTCTGTTTCTTGGTGCTAAT
AAACCAGTTGGAGCTATTGCCTAG(3')GTCTAAATTTTGGCTTGTTTCATGCTTTAAAAAAAAAAAAAAAAACTCGAATGGAATTCCAC
TCCGTCAAAGCACGGGAAACAAAGACCCTACCATTTTCTTAAACAACTTTGTCCTAGAAGCACCCAAGACAAGGGGCAATGATAATGGAA
TGTTAAGATGTAGAGCATAAATAAGATATGGATATAGCATGACATCAACAAATAGACAACATCTTTTTTTTTGGGTTTTAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan