ESTScan Details for Unigene SGN-U632784

Score 
361
Direction 
Forward
Predicted Peptide Sequence 
EDVSAGLVLRRVGVAGFVAEGSQDLVSGLDNAGKTTLLHMLKDERLVQHQPTQYPTSEELSIGKIKFKAFDLGGHQIARRVWKDYYAKVD
AVVYLVDAYDKERFAESKKELDALLSDEALANVPFLILGNKIDIPYAASEDELRYHLGLTGVTTGKGKVNLGDSXRPSFRGVYVQYRAKM
GYGDGLQMGLSIYKVANRQQYDSYSLTLLAEGKQTQFYLFTVPIYYVSSWLRFVWFVLSVCVNWRITQFLMPVKFTCSQDCPASRFVTKT
FFPSCPSALLLWVR*
Predicted Coding Sequence 
GAAGATGTTTCTGCTGGATTGGTTCTACGGCGTGTTGGCGTCGCTGGGTTTGTGGCAGAAGGAAGCCAAGATCTTGTTTCTGGCCTCGAT
AACGCCGGCAAAACCACTCTTCTTCACATGCTCAAAGACGAGAGGCTTGTGCAGCATCAACCGACGCAGTATCCTACGTCGGAGGAGCTC
AGTATTGGCAAAATCAAGTTTAAAGCCTTTGATTTGGGAGGCCATCAGATCGCTCGCCGTGTCTGGAAGGATTACTATGCTAAGGTTGAT
GCAGTGGTATACTTGGTGGATGCTTATGACAAAGAACGCTTTGCTGAATCAAAGAAGGAATTAGATGCACTCCTGTCTGATGAAGCCCTT
GCTAATGTCCCTTTCCTCATTCTGGGTAACAAGATTGACATACCATATGCTGCCTCAGAGGATGAGTTGCGTTACCACCTTGGGCTAACT
GGTGTCACCACTGGCAAAGGGAAGGTAAATCTTGGAGATTCTAAXCGTCCGTCCTTTAGAGGTGTTTATGTGCAGTATCGTGCTAAGATG
GGATATGGTGATGGXCTTCAAATGGGTCTCTCAATATATAAAGTGGCTAATCGTCAGCAATATGATAGTTACAGTCTTACTCTCCTTGCT
GAGGGGAAGCAGACTCAATTTTATCTGTTCACTGTCCCAATTTATTATGTCTCTAGTTGGCTTAGATTTGTATGGTTTGTACTTTCAGTT
TGCGTCAATTGGAGAATTACGCAATTCTTGATGCCTGTAAAATTTACTTGTAGCCAGGACTGCCCAGCGTCTAGATTTGTCACTAAAACA
TTTTTCCCCAGCTGCCCATCTGCTCTTTTATTGTGGGTGAGATAA
Edits in Original Sequence 
GGCCGGGGGAGGCTTCCTTCCTCCCTCGCTGCCTCCCTCCCCCCTCTCTGCCTGCCTCAAAGCCCATCTCATTTCTCTTGTTCTCTCCAG
GGGAGTCGGTACAGTCGGTAAAGAGTAAAAGGGGCAGAGAGAGAGAGAGAGAGAGTAAAAATACTAGTAGTGCTAGAGGAGAGGAGCAGT
TAAACAGATCTCTCCCTCCTTTCTCTTCTAATTTAGAAAGAAGAAGAAGAGAAAACAAACAAACCAAAAAAAAAAAGAAAAAAAAGAAGG
(5')GAAGATGTTTCTGCTGGATTGGTTCTACGGCGTGTTGGCGTCGCTGGGTTTGTGGCAGAAGGAAGCCAAGATCTTGTTTCTaGGCC
TCGATAACGCCGGCAAAACCACTCTTCTTCACATGCTCAAAGACGAGAGGCTTGTGCAGCATCAACCGACGCAGTATCCTACGTCGGAGG
AGCTCAGTATTGGCAAAATCAAGTTTAAAGCCTTTGATTTGGGAGGCCATCAGATCGCTCGCCGTGTCTGGAAGGATTACTATGCTAAGG
TTGATGCAGTGGTATACTTGGTGGATGCTTATGACAAAGAACGCTTTGCTGAATCAAAGAAGGAATTAGATGCACTCCTGTCTGATGAAG
CCCTTGCTAATGTCCCTTTCCTCATTCTGGGTAACAAGATTGACATACCATATGCTGCCTCAGAGGATGAGTTGCGTTACCACCTTGGGC
TAACTGGTGTCACCACTGGCAAAGGGAAGGTAAATCTTGGAGATTCTAAXCGTCCGTCCTTTAGAGGTGTTTATGTGCAGTATCGTGCgT
AAGATGGGATATGGTGATGGXCTTCAAATGGGTCTCTCAATATATAAAGTaGGCTAATCGTCAGCAATATGATAGTTACAGTCTTACTCT
CCTTGCTGAGGGGAAGCAGACTCAATTTTATCTGTTCACTGTCCCAATTTATTATGTCTCTAGTTGGCTTAGATTTGTATGGTTTGTACT
TTCAGTTTGCGTCAATTGGAGAATTACGCAATTCTTGATGCCgTGTAAAATTTACTTGTAGCCAGGACTGCCCAGCGTCTAGATTTGTCA
CTAAAACATTTTTCCCCAGCTGCCCATCTGCTCTTTTATTGTGGGTGAGATAA(3')AACTGAGGCATATCCTCTACAATTCTCTGCTTG
TAGGAAATAATACCATGCTGAGTTGTGGACACCTTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan