Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U633368

Score 
1085
Direction 
Forward
Predicted Peptide Sequence 
MARKSPEEEHPMKAHGWAARDSSGVLSPFKFSRRATLEDDXQIQGAILRDLSYRPSLIKNDWGISTYPFVPGHEIVGEVTEVGSKVTKVK
VGDKVGVGYFLESCRSCENCSEGPGKLLSESGVDLGAPYHDGTKTYGGYSNEMVCNEHFIIRFPENLPLDGGAPLLCAGASVYSPMKYYG
IAKPGSHIGINGLGGLGHVAVKFAKALGAKVTVISTSDRKKDEALNHLGADAFLISRNVEDMKAAAGTMDGILDCVSAKHPLVPLLGLLK
SHGKLVTVGVPAQPLELPIAPLVVGRKLVGGSNVAGIAETQEMIDVAGKHNITADIELVSMEDLNTAMERLAKGDVRYRFVIDVANTLKA
LDLVFGKMLPRSDXPYRFLSDMLWQRLIPSGMVKFGFVFLISSDKFGKLLFVTVSSDLDANXDMILNNVVVSVTSYSRAQQTTGPV*
Predicted Coding Sequence 
ATGGCTAGAAAATCCCCAGAAGAGGAGCACCCAATGAAGGCACATGGATGGGCTGCAAGAGACTCATCTGGGGTCCTTTCCCCCTTCAAA
TTCTCCAGAAGGGCAACACTGGAGGATGATGXTCAGATTCAAGGTGCTATATTGCGGGATCTGTCATACCGACCTTCACTCATTAAGAAT
GATTGGGGAATTTCTACCTACCCTTTTGTACCAGGGCACGAGATTGTGGGTGAAGTTACAGAGGTTGGCAGCAAGGTGACAAAAGTCAAA
GTGGGAGACAAAGTGGGCGTTGGGTACTTCCTTGAGTCATGCCGCTCTTGTGAGAATTGTTCTGAAGGXCCTGGAAAACTATTGTCCGAA
AGTGGTGTTGACCTTGGTGCTCCTTACCATGATGGAACCAAAACGTATGGTGGCTATTCGAATGAGATGGTCTGCAATGAGCACTTTATC
ATTCGCTTCCCAGAGAACTTGCCACTTGATGGGGGTGCACCATTACTTTGTGCAGGAGCTAGTGTGTACAGTCCAATGAAATACTATGGC
ATCGCCAAACCAGGGAGCCACATTGGAATCAATGGCCTTGGTGGGCTTGGTCATGTGGCTGTTAAGTTTGCGAAGGCCTTGGGGGCCAAA
GTGACAGTTATCAGTACGTCTGATCGCAAGAAGGACGAAGCTCTAAACCATCTTGGAGCAGACGCATTTTTGATTAGCCGAAATGTTGAA
GATATGAAGGCTGCTGCTGGCACAATGGATGGTATACTTGACTGTGTCTCAGCTAAGCATCCCTTAGTACCCTTGCTTGGTCTTCTCAAG
TCTCATGGAAAGCTTGTCACTGTGGGGGTACCAGCACAGCCACTTGAGCTTCCTATCGCCCCTCTAGTTGTAGGAAGGAAGTTGGTTGGT
GGAAGTAATGTTGCAGGAATAGCAGAGACACAAGAGATGATTGATGTGGCTGGAAAGCACAACATCACCGCAGATATCGAACTTGTTTCC
ATGGAAGATTTGAACACAGCTATGGAACGTCTTGCAAAAGGTGATGTGAGATATCGCTTTGTCATTGATGTTGCCAACACCTTGAAAGCT
CTTGATCTCGTGTTTGGGAAGATGTTACCAAGATCTGATXTCCCATACAGATTCTTGAGTGACATGCTTTGGCAGCGTCTCATTCCCTCT
GGCATGGTGAAATTTGGTTTTGTCTTCTTAATTTCGAGTGACAAATTTGGGAAGCTACTTTTTGTAACAGTTTCCTCTGACTTGGATGCA
AATGAXGATATGATACTGAATAATGTTGTTGTTTCTGTAACAAGCTATTCCAGGGCTCAGCAGACCACAGGGCCTGTGTGA
Edits in Original Sequence 
GCGACTCTTTCTACTGCAGAAAAGCCGCTTCTTTTTTCCACAGCTCTCTTACTACAAAAAACGATTTGGCCTGTTGATTTCTTTGCTTTC
GCAGCTGATAGCA
(5')ATGGCTAGAAAATCCCCAGAAGAGGAGCACCCAATGAAGGCACATGGATGGGCTGCAAGAGACTCATCTGGGG
TCCTTTCCCCCTTCAAATTCTCCAGAAGGGCAACACTGGAGGATGATGXTCAGATTCAAGGTGCTATATTGCGGGATCTGTCATACCGAC
CTTCACtTCATTAAGAATGATTGGGGAATTTCTACCTACCCTTTTGTACCAGGGCACGAGATTGTGGGTGAAGTTACAGAGGTTGGCAGC
AAGGTGACAAAAGTCAAAGTGGGAGACAAAGTGGGCGTTGGGTACTTCCTTGAGTCATGCCGCTCTTGTGAGAATTGTTCTGAAGGXCCT
GGAAAACTATTGTCCGAAAGTGGTGTTGACCTcTGGTGCTCCTTACCATGATGGAACCAAAACGTATGGTGGCTATTCGAATGAGATGGT
CTGCAATGAGCACTTTATCATTCGCTTCCCAGAGAACTTGCCACTTGATGGGGGTGCACCATTACTTTGTGCAGGAGCTAGTGTGTACAG
TCCAATGAAATACTATGGCATCGCCAAACCAGGGAGCCACATTGGAATCAATGGCCTTGGTGGGCTTGGTCATGTGGCTGTTAAGTTTGC
GAAGGCCTTGGGGGCCAAAGTGACAGTTATCAGTACGTCTGATCGCAAGAAGGACGAAGCTCTAAACCATCTTGGAGCAGACGCATTTTT
GATTAGCCGAAATGTTGAAGATATGAAGGCTGCTGCTGGCACAATGGATGGTATACTTGACTGTGTCTCAGCTAAGCATCCCTTAGTACC
CTTGCTTGGTCTTCTCAAGTCTCATGGAAAGCTTGTCACTGTGGGGGTACCAGCACAGCCACTTGAGCTTCCTATCGCCCCTCTAGTTGT
AGGAAGGAAGTTGGTTGGTGGAAGTAATGTTGCAGGAATAGCAGAGACACAAGAGATGATTGATGTGGCTGGAAAGCACAACATCACCGC
AGATATCGAACTTGTTTCCATGGAAGATTTGAACACAGCTATGGAACGTCTTGCAAAAGGTGATGTGAGATATCGCTTTGTCATTGATGT
TGCCAACACCTTGAAAGCTcCTTGATCTCGTGTTTGGGAAGATGTTACCAAGATCTGATXTCCCATACAGATTCTTGAGTGACATGCTTT
GGCAGCGTCTCATaTCCCTCTGGCATGGTGAAATTTGGTTTTGTCTTCTTAATTTCGAGTGACAAATTTGGGAAGCTACTTTTTGTAACA
GTTTCaCTCTGACTTGGATGCAAATGAXGATATGATACTGAATAATGTTGTTGTTTCTGTAACAAGCTATTCCAGGGCTCAGCAGACCAC
AGGGCCTGTGTGA(3')ACTAGGTGTTGCCTTTATGTTATGTATGCCAGCAGGCTTTGTAAACTCGTACGGAATTGGGATAATACGTCAT
TATGATGCTGTCTCGTGTGTAAATGGAAGAGACAATTAATAATAATAATAATAAAATGTTGCTCTGTGCCTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan