ESTScan Details for Unigene SGN-U633415

Score 
1843
Direction 
Forward
Predicted Peptide Sequence 
XKVREAAXKASSQRSVLQNKAPTLTLSKASSPKSSQNHQKPIFDRLIDWFDSRESKAGRENMDAAKLEELEKFIDQCKANPSILSDPSLS
FFRDYIESLGGKLPPSAYKAGEYKAKSHVAEDLDEDMDDVEDEDHSKVGADEEEEPEIIESDVDLDDTEVVEPDNDPPQQMGDPSVEVSE
ESRDASQEAKAQAMEAISEGKLEDAIEQLTKAISLNPTSAIMYATRATVYIKMKKPNAAVRDANAALEINPDSAKGYKSRGIARAMLGQW
EEAAKDLHVASKLDYDEEISAVLKKVEPNAHKIEEHRRKYERLRKERQDRKIERERQRRKAEAQAAYEKAKKQEKSSSSGRPGGMPGGFP
GGMPGGFPGGSMPGGFPGGMPGGFPGGMPGGMPGNVDYSKILNDPELMAAFKDPEVMAALQDVMKNPANLAQHQNNPKVAPIIAKMMSKF
AGTKVDSWTSVLSGFPXLGHPGCHAVSKLKAVCIFAFHVLQYVFTAAGVEVFILYTIYVGKFKFLNLPNEDYRLMGMLLSLFEEQLAGFV
W
Predicted Coding Sequence 
XGGAAGGTAAGAGAAGCTGCTAGXAAGGCGTCTAGTCAGCGTTCAGTCCTGCAAAACAAAGCACCGACTCTCACTCTAAGCAAAGCAAGT
TCCCCCAAATCATCACAAAATCATCAAAAACCCATTTTTGACCGATTGATTGATTGGTTTGATAGCAGAGAGAGCAAAGCCGGAAGAGAA
AACATGGACGCGGCGAAGTTGGAAGAATTGGAGAAATTCATAGATCAATGCAAAGCAAACCCTTCCATTCTCTCCGACCCCTCCCTCTCC
TTTTTCCGCGACTACATCGAAAGCCTTGGGGGAAAGCTTCCACCATCTGCTTACAAGGCTGGAGAGTATAAGGCGAAGTCTCATGTGGCC
GAGGATCTTGATGAGGATATGGATGATGTTGAGGATGAGGATCACTCAAAGGTGGGTGCTGATGAAGAAGAGGAGCCTGAGATAATCGAA
TCTGATGTTGACCTTGATGACACTGAAGTTGTGGAGCCTGATAATGATCCTCCGCAACAGATGGGAGACCCTTCGGTTGAGGTTAGTGAA
GAAAGTCGTGATGCTTCTCAAGAGGCAAAGGCTCAGGCAATGGAGGCAATTTCTGAAGGAAAGCTGGAGGATGCAATTGAGCAGCTTACA
AAAGCAATCTCACTCAATCCTACATCCGCAATCATGTATGCTACCAGAGCTACCGTGTATATCAAAATGAAGAAACCAAATGCTGCAGTC
AGAGATGCCAATGCAGCTCTGGAGATTAACCCTGATTCTGCTAAAGGGTACAAATCCCGTGGCATCGCACGAGCAATGCTTGGCCAGTGG
GAGGAGGCTGCCAAGGATCTTCACGTAGCTTCTAAGCTGGATTACGATGAAGAGATCAGTGCTGTACTGAAGAAGGTTGAGCCTAATGCT
CACAAGATTGAGGAGCACCGTAGGAAATATGAAAGGCTTCGCAAAGAAAGGCAAGATAGAAAGATAGAACGAGAGAGACAGCGTCGCAAG
GCTGAAGCTCAGGCTGCTTATGAAAAGGCTAAGAAGCAAGAGAAGTCATCATCAAGTGGAAGACCTGGAGGCATGCCAGGTGGGTTCCCA
GGTGGGATGCCTGGTGGTTTCCCTGGAGGCAGCATGCCTGGTGGTTTCCCTGGAGGCATGCCTGGTGGTTTTCCTGGGGGCATGCCTGGA
GGGATGCCTGGGAATGTTGACTACAGCAAGATATTGAATGATCCTGAACTAATGGCAGCATTCAAAGATCCAGAAGTCATGGCTGCTCTC
CAAGATGTGATGAAGAATCCTGCCAATTTGGCCCAGCATCAAAATAATCCAAAGGTAGCTCCCATCATTGCAAAAATGATGAGTAAATTT
GCXGGGACCAAAGTAGATTCCTGGACTAGTGTATTATCTGGTTTTCCAXCACTCGGACATCCAGGGTGTCACGCGGTATCCAAGCTGAAA
GCAGTGTGCATCTTTGCTTTCCATGTATTGCAATATGTCTTTACTGCAGCAGGAGTTGAGGTTTTCATTTTATACACTATTTATGTTGGA
AAGTTTAAATTTTTAAATCTCCCAAATGAAGATTATCGATTGATGGGAATGCTGCTCAGTCTTTTTGAAGAACAGTTGGCCGGTTTTGTG
TGG
Edits in Original Sequence 
(5')XGGAAGGTAAGAGAAGCTGCTAGXAAGGCGTCTAGTCAGCGTTCAGTCCTGCAAAACAAAGCACCGACTCTCACTCTAAGCAAAGC
AAGTTCCCCCAAATCATCACAAAATCATCAAAAACCCATTTTTGACCGATTGATTGATTGGTTTGATAGCAGAGtAGAGCAAAGCCGGAA
GAGAAAACATGGACGCGGCGAAGTTGGAAGAATTGGAGAAATTCATAGATCAATGCAAAGCAAACCCTTCCATTCTCTCCGACCCCTCCC
TCTCCTTTTTCCGCGACTACATCGAAAGCCTTGGGGGAAAGCTTCCACCATCTGCTTACAAGGCTGGAGAGTATAAGGCGAAGTCTCATG
TGGCCGAGGATCTTGATGAGGATATGGATGATGTTGAGGATGAGGATCACTCAAAGGTGGGTGCTGATGAAGAAGAGGAGCCTGAGATAA
TCGAATCTGATGTTGACCTTGATGACACTGAAGTTGTGGAGCCTGATAATGATCCTCCGCAACAGATGGGAGACCCTTCGGTTGAGGTTA
GTGAAGAAAGTCGTGATGCTTCTCAAGAGGCAAAGGCTCAGGCAATGGAGGCAATTTCTGAAGGAAAGCTGGAGGATGCAATTGAGCAGC
TTACAAAAGCAATCTCACTCAATCCTACATCCGCAATCATGTATGCTACCAGAGCTACCGTGTATATCAAAATGAAGAAACCAAATGCTG
CAGTCAGAGATGCCAATGCAGCTCTGGAGATTAACCCTGATTCTGCTAAAGGGTACAAATCCCGTGGCATCGCACGAGCAATGCTTGGCC
AGTGGGAGGAGGCTGCCAAGGATCTTCACGTAGCTTCTAAGCTGGATTACGATGAAGAGATCAGTGCTGTACTGAAGAAGGTTGAGCCTA
ATGCTCACAAGATTGAGGAGCACCGTAGGAAATATGAAAGGCTTCGCAAAGAAAGGCAAGATAGAAAGATAGAACGAGAGAGACAGCGTC
GCAAGGCTGAAGCTCAGGCTGCTTATGAAAAGGCTAAGAAGCAAGAGAAGTCATCATCAAGTGGAAGACCTGGAGGCATGCCAGGTGGGT
TCCCAGGTGGGATGCCTGGTGGTTTCCCTGGAGGCAGCATGCCTGGTGGTTTCCCTGGAGGCATGCCTGGTGGTTTTCCTGGGGGCATGC
CTGGAGGGATGCCTGGGAATGTTGACTACAGCAAGATATTGAATGATCCTGAACTAATGGCAGCATTCAAAGATCCAGAAGTCATGGCTG
CTCTCCAAGATGTGATGAAGAATCCTGCCAATTTGGCCCAGCATCAAAATAATCCAAAGGTAGCTCCCATCATTGCAAAAATGATGAGTA
AATTTGCXGGGACCAAAGTAGATTCCTGGACTAGTGTATTATCTGGTTTTCCAXCACTCGGACATCCAGGGTGTCACGCGGTATCCAAGC
TGAAAGtCAGTGTGCATCTTTGCTTTCCATGTATTGCAATATGTCTTTACTGCAGCAGGAGTTGAGGTTTTCATTTTATACACTATTTAT
GTTGGAAAGTTTAAATTTTTAAATCTCCCAtAATGAAGATTATCGATTGATGGGAATGCTGCTCAGTCTTTTTGAAGAACAGTTGGCCGG
TTTTGTGTGG(3')TAGATTGTTGGTTATATGTAGCTAAAATCTATTCCCTCGTGCTTTTCTTTTGGGCTGGGATCTGTATTTCTTGTCT
TTTTA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan