ESTScan Details for Unigene SGN-U635084

Score 
1098
Direction 
Forward
Predicted Peptide Sequence 
XILGKVESASEVQTLLFSATLPDWVKQIAAKFLKPDKKTADLIGNEKMKASASVRHIVLPCSTSARAQLIPDIIHCYSRGGQTIIFTETK
DSASELAGLLPGARALHGDIQQSQREVTLSAFKSGKFTTLVATNVAARGLDIDNVQLIIQCEPPRDVEAYIHRSGRTGRAGNTGVAVMLY
DPRRSNISKIERECGVKFEHVSAPQPADIAEAAGAEAAGKISQISDSVIPAFKAAAEELLNNSNLSPVELLAKALAKAAGXFRDQESFNP
YFHGKPCHVTTGGGRPIYTPSFAYSVLRRFLPEEKVESIKGLALTADGKGAVFDVAAEDLDFFVKGQEGAGGVSLDVVKLLPRLQDRDQV
RGGRFGSGGRGGFSDRRGGGNRFSGGRGGRGGSSDRRNGQFSKSPSGGGGFRNNNLNGEAFLPEMAA*
Predicted Coding Sequence 
XXGATTCTAGGCAAGGTTGAAAGTGCAAGCGAAGTTCAAACACTCCTTTTTAGTGCCACGTTACCTGATTGGGTGAAGCAAATTGCAGCC
AAGTTCCTGAAACCTGATAAGAAAACTGCAGACCTAATTGGCAATGAGAAAATGAAGGCTAGTGCAAGTGTCAGGCATATTGTCCTGCCT
TGCTCTACTTCAGCAAGAGCCCAACTTATTCCTGACATTATTCATTGCTATAGCAGAGGAGGTCAAACTATTATTTTCACTGAGACAAAG
GATTCAGCTTCTGAACTTGCTGGCTTATTGCCAGGAGCACGTGCTTTGCATGGTGACATACAGCAGTCCCAGCGAGAGGTTACACTCAGC
GCCTTCAAATCCGGGAAGTTCACCACATTAGTGGCCACAAATGTGGCAGCACGTGGATTGGACATTGACAATGTCCAGTTGATAATCCAG
TGTGAGCCCCCACGAGATGTAGAAGCATATATCCATCGTTCTGGACGTACAGGCAGAGCGGGGAACACTGGTGTTGCTGTAATGCTTTAT
GATCCTAGGAGATCAAACATTTCTAAGATAGAAAGAGAATGTGGTGTGAAGTTTGAACATGTATCTGCTCCACAGCCAGCTGATATTGCT
GAAGCAGCTGGTGCAGAAGCTGCAGGAAAAATTTCCCAAATCTCTGACAGCGTCATTCCGGCATTTAAGGCTGCTGCAGAGGAGCTACTG
AACAACTCTAATTTATCCCCAGTAGAACTTCTTGCAAAAGCTCTTGCCAAGGCTGCTGGTXTATTCAGAGATCAAGAGTCGTTCAATCCT
TACTTCCATGGAAAACCATGTCACGTTACTACTGGAGGTGGAAGGCCCATCTACACGCCCTCCTTTGCTTACAGTGTGCTGCGAAGGTTC
TTACCTGAAGAAAAGGTCGAGTCAATTAAGGGTCTTGCTTTAACGGCTGATGGAAAAGGGGCCGTGTTTGATGTGGCTGCTGAAGATCTG
GACTTTTTTGTCAAGGGCCAGGAAGGTGCTGGTGGGGTTAGCTTGGATGTTGTGAAGTTATTGCCACGGTTGCAAGATAGAGACCAGGTA
AGAGGTGGAAGATTTGGAAGTGGTGGTCGTGGCGGCTTTTCTGATAGGAGGGGGGGTGGTAATCGGTTCTCTGGGGGAAGAGGGGGAAGA
GGCGGCTCATCTGATAGGAGGAATGGTCAGTTCTCCAAAAGTCCAAGCGGTGGGGGAGGTTTCAGAAATAACAACCTAAATGGTGAAGCT
TTCTTGCCXGAAATGGCAGCTTGA
Edits in Original Sequence 
(5')XXGATTCTAGGCAAGGTTGAAAGTGCAAGCGAAGTTCAAACACTCCTTTTTAGTGCCACGTTACCTGATTGGGTGAAGCAAATTGC
AGCCAAGTTCCTGAAACCTGATAAGAAAACTGCAGACCTAATTGGCAATGAGAAAATGAAGGCTAGTGCAAGTGTCAGGCATATTGTCCT
GCCTTGCTCTACTTCAGCAAGAGCCCAACTTATTCCTGACATTATTCATTGCTATAGCAGAGGAGGTCAAACTATTATTTTCACTGAGAC
AAAGGATTCAGCTTCTGAACTTGCTGGCTTATTGCCAGGAGCACGTGCTTTGCATGGTGACATACAGCAGTCCCAGCGAGAGGTTACACT
CAGCGCCTTCAAATCCGGGAAGTTCACCACATTAGTGGCCACAAATGTGGCAGCACGTGGATTGGACATTGACAATGTCCAGTTGATAAT
CCAGTGTGAGCCCCCACGAGATGTAGAAGCATATATCCATCGTTCTGGACGTACAGGCAGAGCGGGGAACACTGGTGTTGCTGTAATGCT
TTATGATCCTAGGAGATCAAACATTTCTAAGATAGAAAGAGAATGTGGTGTGAAGTTTGAACATGTATCTGCTCCACAGCCAGCTGATAT
TGCTGAAGCAGCTGGTGCAGAAGCTGCAGGAAAAATTTCCCAAATCTCTGACAGCGTCATTCCGGCATTTAAGGCTGCTGCAGAGGAGCT
ACTGAACAACTCTAATTTATCCCCAGTAGAACTTCTTGCAAAAGCTCTTGCCAAGGCTGCTGGTXTATTCAGAGATCAAGAGTCGTTCAA
TCCTTACTTCCATGGAAAACCATGTCACGTTACTACTGGAGtGTGGAAGGCCCATCTACACGCCCTCCTTTGCTTACAGTGTGCTGCGAA
GGTTCTTACCTGAAGAAAAGGTCGAGTCAATTAAGGGTCTTGCTTTAACGGCTGATGGAAAAGGGGCCGTGTTTGATGTGGCTGCTGAAG
ATCTGGACTTTTTTGTCAAGGGCCAGGAAGGTGCTGGTGGGGTTAGCTTGGATGTTGTGAAGTTATTGCCACGGTTGCAAGATAGAGACC
AGGTAAGAGGTGGAAGATTTGGAAGTGGTGGTCGTGGCGGCTTTTCTGATAGGAGGGGGGGTGGTAATCGGTTCTCTGGGGGAAGAGGGG
GAAGAGGCGGCTCATCTGATAGGAGGAATGGTCAGTTCTCCAAAAGTCCAAGCGGTGGGGGAGGTTTCAGAAATAACAACCgTAAATGGT
GAAGCTTTCTTGCCXGAAATGGCAGCTTGA(3')AATTTTGTGGTGGTTTTTATGAGTTATTCTGTTTTTCTTAATTAAGCAATTCAATT
GACAATTTTTTAGTAGGTGCATCCCATATCTGGTGCCTGTATGTTTCGGTTTCTATGTATGTCCCATTTTTTCCCCAGATTATAATTCTA
CAATAGAGAGTTTTGGGGGTTTTGCTGGGTTCCCCATCTTAGGTCCTTGATTTTGCAGAAACTGGGAGATTTGTATCTTCAATCTGCGAT
AGAGCTCAGTGTATCTTCAATTAATTATCGAATCATCTTAGATGTTTGGGAGAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan