ESTScan Details for Unigene SGN-U635394

Score 
415
Direction 
Forward
Predicted Peptide Sequence 
MALKLSSLVSPSVVRRRLPLVGAFCVLSFGLSNLCPSFNPSSKTGCAQSLHFLPILGSKVGSSVHSTNRIRMEASSKTVPSIVVYVTVPN
KEAGKKLAESIVKEKLAACVNRVPGIESVYEWKGEVQTDPEELLIIKTRESLLDALTQHVKANHEYEVPEVIALPITGGNLQYLEWIKKA
QGTELVKAKTIYRNMHRFLE*
Predicted Coding Sequence 
ATGGCATTAAAGCTCTCATCTTTAGTATCACCTTCAGTAGTTCGTCGCCGATTACCACTAGTAGGTGCTTTCTGTGTCCTAAGCTTCGGT
CTTTCCAATCTCTGCCCCTCTTTTAATCCCTCCTCTAAAACGGGTTGTGCTCAATCCCTCCACTTTCTCCCAATCTTGGGATCAAAAGTT
GGTAGTAGTGTTCATAGTACAAATAGGATAAGGATGGAAGCAAGCAGCAAAACTGTTCCCAGCATTGTTGTCTATGTCACTGTTCCAAAT
AAAGAAGCTGGTAAGAAACTGGCAGAAAGCATAGTTAAAGAAAAGCTTGCAGCCTGTGTAAACCGAGTTCCAGGAATAGAGTCTGTTTAT
GAGTGGAAAGGGGAGGTGCAGACAGATCCTGAAGAGTTGCTAATAATTAAGACTAGGGAGTCACTTTTGGATGCTCTGACACAGCATGTC
AAGGCGAATCACGAATACGAGGTGCCAGAAGTGATCGCCTTGCCCATAACCGGTGGCAACCTCCAATATCTTGAATGGATAAAGAAAGCA
CAAGGGACTGAACTGGTTAAAGCCAAGACTATATACAGGAATATGCATCGTTTCTTGGAATAA
Edits in Original Sequence 
ACTATAAAGCCCCACCAAATTCCAATCTTAA(5')ATGGCATTAAAGCTCTCATCTTTAGTATCACCTTCAGTAGTTCGTCGCCGATTAC
CACTAGTAGGTGCTTTCTGTGTCCTAAGCTTCGGTCTTTCCAATCTCTGCCCCTCTTTTAATCCCTCCTCTAAAACGGGTTGTGCTCAAT
CCCTCCACTTTCTCCCAATCTTGGGATCAAAAGTTGGTAGTAGTGTTCATAGTACAAATAGGATAAGGATGGAAGCAAGCAGCAAAACTG
TTCCCAGCATTGTTGTCTATGTCACTGTTCCAAATAAAGAAGCTGGTAAGAAACTGGCAGAAAGCATAGTTAAAGAAAAGCTTGCAGCCT
GTGTAAACCGAGTTCCAGGAATAGAGTCTGTTTATGAGTGGAAAGGGGAGGTGCAGACAGATCCTGAAGAGTTGCTAATAATTAAGACTA
GGGAGTCACTTTTGGATGCTCTGACACAGCATGTCAAGGCGAATCACGAATACGAGGTGCCAGAAGTGATCGCCTTGCCCATAACCGGTG
GCAACCTCCAATATCTTGAATGGATAAAGAAtAGCACAAGGGACTGAACTGGTTAAAGCCAAGACTATATACAGGAATATGCATCGTTTC
TTGGAATAA(3')ATAAATTCCCTTTTGGTTGTATATATAGCACTTTGTGCATACTGTCGCATGAGCAGTGGATGTTTATGTTGCCTTTT
ACTAATAGATTGGATTGGATATTGTTTGCCTGAAAAAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan