ESTScan Details for Unigene SGN-U635840

Score 
892
Direction 
Forward
Predicted Peptide Sequence 
GRGAFGWTFSAFPLSLISIHLFLCFFVSGSKNNLGLAEWELRVIFIQENGDXKSELWLKNFHGNFLTHFSRPYLLSMEVPGEDEVKKAED
RMTSAAAFVEGGIQEACDDSAAYALKPSAESDPSTVTFASMSFTFNVFLNGVKEVRIXPMCWQTISLKDPASQQLLDAVEREKRIRFTPA
RNATIFHHPTLGDFELQHLPVGVNDSELEERIIQHLAAAAAMGRARHIARREGSRGHSSAQGRPHFLVFSTHASAPGPGAGPASASVGAE
PEADATAPVNDPSSLTEQSAVNHCNAPPNLTSVPSGQLSASSSGSVAMLNNPRDLSTDNRSVARQAPSGQDRAGTSDFQSFSDSWRSRFS
AMSMKYKESLSKSTRGWKERLFARSNSMADIRSEVRREVNAGIASVSRMMERLETRENSRPGPVSTSNNPPVTEQNNPGNLDESPLSDIS
ALPANSXLALSGIHCLAVASFLSIAALEVIKTRPPNGNADRGCLYGQGRMLKTTITDXMMPIRXKKEPEAEQRFLR*
Predicted Coding Sequence 
GGCCGGGGGGCTTTTGGTTGGACCTTTTCGGCTTTTCCTCTTTCTCTAATCTCTATCCATCTCTTTCTTTGTTTCTTTGTCTCTGGGTCC
AAGAATAATTTGGGCTTAGCTGAATGGGAACTTAGAGTTATCTTCATCCAGGAAAATGGGGATAAXAAATCAGAGCTTTGGCTTAAAAAT
TTCCATGGAAATTTCTTGACCCATTTTTCTAGGCCATATCTTCTTTCAATGGAGGTTCCGGGGGAGGATGAGGTTAAAAAGGCAGAGGAT
CGTATGACATCAGCCGCGGCTTTTGTTGAAGGAGGTATACAGGAGGCATGTGATGATTCTGCAGCATATGCCTTGAAGCCTTCTGCXGAA
AGTGATCCATCCACGGTAACATTTGCAAGCATGAGTTTCACCTTCAATGTATTCTTGAATGGTGTCAAAGAAGTTCGAATTGXTCCAATG
TGCTGGCAAACTATAAGTTTGAAAGATCCTGCTAGTCAACAATTGCTTGATGCTGTAGAAAGAGAGAAACGTATTAGGTTCACTCCAGCA
AGAAATGCCACGATATTTCATCATCCCACTCTGGGGGATTTTGAACTGCAACACTTGCCTGTTGGAGTTAATGATTCTGAACTGGAAGAA
CGCATTATTCAGCACTTGGCTGCTGCTGCTGCAATGGGAAGGGCACGTCATATTGCTCGTAGAGAGGGCTCAAGGGGTCACTCATCTGCT
CAGGGTCGTCCACATTTTCTGGTGTTTTCCACACATGCCAGTGCCCCAGGTCCAGGCGCTGGTCCTGCTTCAGCTTCTGTAGGAGCGGAA
CCTGAGGCAGATGCAACAGCCCCTGTTAATGATCCTTCTTCACTCACCGAGCAATCAGCAGTGAATCATTGCAATGCACCXCCAAATCTT
ACTAGTGTTCCTAGTGGTCAACTCTCTGCTTCGTCATCTGGATCAGTTGCCATGCTTAACAACCCTCGAGATCTCTCCACTGACAATAGA
AGCGTGGCTCGTCAGGCACCATCAGGTCAAGATAGAGCAGGAACATCAGATTTCCAGTCTTTTTCAGATTCCTGGAGATCTCGTTTTAGT
GCAATGTCAATGAAATACAAAGAATCTCTTTCAAAGAGCACAAGAGGATGGAAAGAAAGGCTTTTTGCACGAAGTAATTCCATGGCAGAT
ATTCGCTCAGAAGTTAGGAGAGAAGTGAATGCTGGAATTGCTAGTGTTTCCCGCATGATGGAACGCCTAGAAACAAGAGAAAACAGTAGA
CCTGGTCCTGTTTCAACGTCAAATAATCCTCCAGTGACTGAGCAAAATAACCCTGGGAATTTGGATGAATCACCGTTGAGTGACATTTCG
GCTCTTCCTGCAAATTCTGXTCTCGCGTTAAGTGGTATACATTGTTTAGCTGTTGCATCTTTCCTCAGCATTGCAGCTTTGGAGGTTATT
AAAACTCGTCCTCCAAATGGAAATGCTGATAGAGGATGCTTATATGGGCAGGGCAGAATGTTGAAAACAACCATTACTGATAXGATGATG
CCAATTAGGGAXAAGAAAGAGCCTGAAGCGGAACAACGATTTCTGCGTTAA
Edits in Original Sequence 
(5')GGCCGGGGGGCTTTTGGTTGGACCTTTTCGGCTTTTCCTCTTTCTCTAATCTCTATCCATCTCTTTCTTTGTTTCTTTGTCTCTGG
GTCCAAGAATAATTTGGGCTTAGCTGAATGGGAACTTAGAGTTATCTTCATCCAGGAAAATaGGGGATAAXAAATCAGAGCTTTGGCTTA
AAAATTTCCATGGAAATTTCTTGACCCATTTTTCTAGGCCATATCTTCTTTCAATGGAGGTTCCGGGGGAGGATGAGGTTAAAAAGGCAG
AGGATCGTATGACATCAGCCGCGGCTTTTGTTGAAGGAGGTATACAGGAGGCATGTGATGATTCaTGCAGCATATGCCTTGAAGCCTTCT
GCXGAAAGTGATCCATCCACGGTAACtATTTGCAAGCATGAGTTTCACCTTCAATGTATTCTTGAATGGTGTCAAAGAAGTTCGAATTGX
TCCAATGTGCTGGCAAACTATAAGTTTGAAAGATCCTGCTAGTCAACAATTGCTTGATGCTGTAGAAAGAGAGAAACGTATTAGGTTCAC
TCCAGCAAGAAATGCCACGATATTTCATCATCCCACTCTGGGGGATTTTGAACTGCAACACTTGCCTGTTGGAGTTAATGATTCTGAACT
GGAAGAACGCATTATTCAGCACTTGGCTGCTGCTGCTGCAATGGGAAGGGCACGTCATATTGCTCGTAGAGAGGGCTCAAGGGGTCACTC
ATCTGCTCAGGGTCGTCCACATTTTCTGGTGTTTTCCACACATGCCAGTGCCCCAGGTCCAGGCGCTGGTCCTGCTTCAGCTTCTGTAGG
AGCGGAACCTGAGGCAGATGCAACAGCCCCTGTTAATGATCCTTCTgTCACTCACCGAGCAATCAGCAGTGAATCATTGCAATGCACCXC
CAAATCTTACTAGTGTTCCTAGTGGTCAACTCTCTGCTTCGTCATCTGGATCAGTTGCCATGCTTAACAACCCTCGAGATCTCTCCACTG
ACAATAGAAGCGTGGCTCGTCAGGCACCATCAGGTCAAGATAGAGCAGGAACATCAGATTTCCAGTCTTTTTCAGATTCCTGGAGATCTC
GTTTTAGTGCAATGTCAATGAAATACAAAGAATCTCTTTCAAAGAGCACAAGAGGATGGAAAGAAAGGCTTTTTGCACGAAGTAATTCCA
TGGCAGATATTCGCTCAGAAGTTAGGAGAGAAGTGAATGCTGGAATTGCTAGTGTTTCCCGCATGATGGAACGCCTAGAAACAAGAGAAA
ACAGTAGACCTGGTCCTGTTTCAACGTCAAATAATCCTCCAGTGACTGAGCAAAATAACCCTGGGAATTTGGATGAATCACCGTTGAGTG
ACATTTCGGCTCTTCCTGCAAATTCTGXTCTCGCGTTAAGTGGTATACATTGTTTaAGCTGTTGCATCTTTCCTCAGCATTGCAGCTTTG
GAGGTTATTAAAACTCGTCCTCCAAATGtGAAATGCTGATAGAGGATGCTTATATGGGCAGGGCAGAATGTTGAAAACAACCATTACTGA
TAXGATGATGCCAATTAGGGAXAAGAAAGAGCCTGAAGCGGAACAACGATTTCTGCGTTAA(3')AAAGCTGTAAATTTGTTTATGCAAA
CTTGGGTTTGTTATGTATTGCACTCCAATGCTTGTAATAGCTGTTGGACTGAAGTGGCAGTCTTCTATACCCTTCTGCTTGAGAACTAAT
TTTTCTCTAATTCTAAGGCTGAAGGCTAATGAGCCCCAGC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan