ESTScan Details for Unigene SGN-U636012

Score 
252
Direction 
Forward
Predicted Peptide Sequence 
XRPLFIKLPDGYVQEAANPIWEYHKYIPYSKPEKKVHDQILLYGTPKDLDDFCLKAQLVNYIQYRALLEGWTSRMWSKYTGVLSGKLIIP
GQVSGANSMIISMTKQQGSMAVAXAAKPIHVQLNLATYYIEVVNTTSGELSSVAIEASVWNLDGMCPYYEVSEKLTVPSKRTVPIFEMKY
PKSKNAKPVYFLLLKLYNISDYGILSRNLYWLHLPGGDYKLLEPYRNKKVPLKITSQALKGDPPVKS
Predicted Coding Sequence 
XXCAGGCCTTTGTTTATAAAGCTGCCAGATGGCTATGTACAGGAAGCTGCAAATCCCATATGGGAATACCACAAGTACATTCCATATTCA
AAACCAGAGAAGAAGGTTCATGATCAGATTTTGCTTTATGGGACCCCAAAAGATCTTGATGATTTTTGTCTTAAGGCACAACTAGTTAAT
TATATCCAGTATAGAGCTCTCTTAGAAGGCTGGACCTCGCGTATGTGGAGCAAGTATACAGGAGTTTTATCTGGAAAACTCATAATCCCT
GGACAGGTCTCCGGGGCCAATTCTATGATCATCTCCATGACCAAACAGCAGGGTTCTATGGCTGTCGCTGXTGCTGCAAAACCTATCCAT
GTTCAACTTAATCTGGCAACATATTACATCGAGGTGGTTAATACTACATCTGGTGAACTCTCTAGTGTGGCTATAGAAGCCTCCGTGTGG
AATCTGGATGGGATGTGCCCATATTATGAAGTGTCTGAAAAGCTCACCGTACCATCTAAAAGAACAGTACCTATCTTTGAGATGAAATAT
CCCAAGTCTAAAAATGCAAAGCCAGTTTACTTCCTCCTCCTTAAACTGTATAACATATCGGACTATGGCATATTGTCAAGGAACTTGTAC
TGGTTGCATTTACCAGGTGGTGATTACAAGCTCTTGGAACCCTACAGGAATAAGAAAGTGCCACTTAAAATAACATCTCAAGCTTTAAAA
GGGGATCCACCTGTGAAGTCX
Edits in Original Sequence 
(5')XXCAGGCCTTTGTTTATAAAGCTGCCAGATGGCTATGTACAGGAAGCTGCAAATCCCATATGGGAATACCACAAGTACATTCCATA
TTCAAAACCAGAGAAGAAGGTTCATGATCAGATTTTGCTTTATGGGACCCCAAAAGATCTTGATGATTTTTGTCTTAAGGCACAACTAGT
TAATTATATCCAGTATAGAGCTCTCTTAGAAGGCTGGACCTCGCGTATGTGGAGCAAGTATACAGGAGTTTTaATCTGGAAAACTCATAA
TCCCTGGACAGGTCTCCGGGGCCAATTCTATGATCATCTCCATGACCAAACAGCAGGGTTCTATGGCTGTCGCTGXTGCTGCAAAACCTA
TCCATGTTCAACTTAATCTGGCAACATATTACATCGAGGTGGTTAATACTACATCTGGTGAACTCTCTAGTGTGGCTATAGAAGCCTCCG
TGTGGAATCTGGATGGGATGTGCCCATATTATGAAGTGTCTGAAAAGCTCACCGTACCATCTAAAAGAACAGTACCTATCTTTGAGATGA
AATATCCCAAGTCTAAAAATGCAAAGCCAGTTTACTTCCTCCTCCTTAAACTGTATAACATATCGGACTATGGCATATTGTCAAGGAACT
TGTACTGGTTGCATTTACCAGGTGGTGATTACAAGCTCTTGGAACCCTACAGGAATAAGAAAGTGCCACTTAAAATAACATCTCAAGCTT
TAAtAAGGGGATCCACCTGTGAAGTCX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan