ESTScan Details for Unigene SGN-U636098

Score 
820
Direction 
Forward
Predicted Peptide Sequence 
MRPILMKGHERPLTFLKYNRDGDLLFSCAKDHTPTSGSPTMANASALIVATTAPSGVAMSPGIRLXLLTGSADQTAKLWNVKTGTQLYTF
NFDSPTRSVDFGVGDKLAVITTDPFMGLPSAIQVKRIARDPADQSGESILVLKGPQGRINRAVWGPLNKTIISGGEDSVIRIWDSETGKL
LKESDKEAGHKKGITSLSKSNDATHFISGSLDKSAKLWDMRTLTLLKTYTTERPVNAVAMSPLLDHVVLGGGQDASAVTTTDHRAGKFEA
KFYDKVLQEEIGGVKGHFGPINALAFNPDGKSFASGGEDGYVRLHHFDPDYFNIKSRLXIVKLRDLLSPTALVXLMANNFACGSYLKALV
YGSPVFVINLILQLEETVPKKKKEKL*
Predicted Coding Sequence 
ATGAGGCCGATACTGATGAAAGGCCATGAGAGGCCGCTGACATTTTTGAAGTACAACAGAGACGGCGACCTTCTATTCTCGTGCGCCAAG
GATCATACTCCAACCTCTGGTTCGCCGACAATGGCGAACGCCTCGGCACTTATCGTGGCCACAACGGCGCCGTCTGGTGTTGCGATGTCT
CCAGGGATTCGTCTTXTGCTGTTAACTGGAAGTGCGGATCAGACAGCAAAACTTTGGAATGTTAAAACAGGGACTCAGCTGTACACTTTC
AACTTCGACTCACCAACTAGGTCTGTTGATTTTGGAGTTGGTGATAAACTTGCTGTCATAACAACTGACCCCTTTATGGGATTGCCTTCT
GCAATTCAAGTGAAACGAATTGCCAGAGATCCTGCTGACCAGTCCGGTGAATCTATTCTTGTACTCAAAGGACCTCAGGGAAGAATTAAC
AGGGCTGTTTGGGGACCTTTGAACAAGACTATCATAAGTGGTGGTGAAGATTCTGTAATACGTATCTGGGATTCTGAGACTGGGAAATTA
CTCAAAGAGTCTGACAAGGAGGCTGGTCACAAAAAAGGCATAACATCACTTTCAAAATCCAATGATGCGACGCATTTCATCAGTGGTTCT
CTTGATAAGTCAGCTAAACTGTGGGATATGAGAACATTGACACTTCTGAAGACCTATACAACTGAACGTCCTGTGAATGCAGTTGCAATG
TCTCCGCTTCTTGATCATGTGGTTCTTGGAGGTGGTCAGGATGCATCAGCTGTTACTACCACTGACCATCGTGCTGGAAAGTTTGAGGCA
AAATTCTATGACAAGGTTCTTCAAGAAGAGATTGGAGGGGTTAAAGGTCACTTTGGGCCAATCAACGCCTTGGCATTCAATCCTGACGGA
AAAAGTTTCGCAAGTGGAGGTGAAGATGGGTATGTGAGACTGCATCACTTTGATCCGGACTACTTCAACATCAAGTCTAGACTAGAXATC
GTCAAATTAAGGGATCTCCTTTCTCCAACAGCTCTTGTAGXTCTAATGGCCAACAATTTTGCTTGTGGATCTTACTTAAAAGCTCTAGTC
TATGGAAGCCCTGTATTCGTGATTAATCTTATTTTACAACTTGAGGAAACTGTGCCTAAAAAGAAAAAGGAGAAGCTATAG
Edits in Original Sequence 
GTCCAAGTCTCTTTCTGTTACCAGAACCAACTAGGGTTTTTGTTTCCTTTGTTCTTCTTCTTCTTCTTCTTTTTTCCTTTGTTAAACCAC
AGTTTTGTCGTTCACCAAATCACAATCATAATCTAGTAAGTTTTGCCGTATACTG
(5')ATGAGGCCGATACTGATGAAAGGCCATGAGA
GGCCGCTGACATTTTTGAAGTACAACAGAGACGGCGACCTTCTATTCTCGTGCGCCAAGGATCATACTCCAACCgTCTGGTTCGCCGACA
ATGGCGAACGCCTCGGCACTTATCGTGGCCACAACGGCGCCGTCTGGTGTTGCGATGTCTCCAGGGATTCGTCTTXTGCTGTTAACTGGA
AGTGCGGATCAGACAGCAAAACTTTGGAATGTTAAAACAGGGACTCAGCTGTACACTTTCAACTTCGACTCACCAACTAGGTCTGTTGAT
TTTGGAGTTGGTGATAAACTTGCTGTCATAACAACTGACCCCTTTATGGGATTGCCTTCTGCAATTCAAGTGAAACGAATTGCCAGAGAT
CCTGCTGACCAGTCCGGTGAATCTATTCTTGTACTCAAAGGACCTCAGGGAAGAATTAACAGGGCTGTTTGGGGACCTTTGAACAAGACT
ATCATAAGTGGTGGTGAAGATTCTGTAATACGTATCTGGGATTCTGAGACTGGGAAATTACTCAAAGAGTCTGACAAGGAGGCTGGTCAC
AAAAAAGGCATAACATCACTTTCAAAATCCAATGATGCGACGCATTTCATCAGTGGTTCTCTTGATAAGTCAGCTAAACTGTGGGATATG
AGAACATTGACACTTCTGAAGACCTATACAACTGAACGTCCTGTGAATGCAGTTGCAATGTCTCCGCTTCTTGATCATGTGGTTCTTGGA
GGTGGTCAGGATGCATCAGCTGTTACTACCACTGACCATCGTGCTGGAAAGTTTGAGGCAAAATTCTATGACAAGGTTCTTCAAGAAGAG
ATTGGAGGGGTTAAAGGTCACTTTGGGCCAATCAACGCCTTGGCATTCAATCCTGACGGAAAAAGTTTCGCAAGTGGAGGTGAAGATGGG
TATGTGAGACTGCATCACTTTGATCCGGACTACTTCAACATCAAGaTCTAGACTAGAXATCGTCAAATTAAGGGATCTCCTTTCTCCAAC
AGCTCTTGTAGXTCTAATGGCCAACAATTTTGCTTGTGGATCTTACTTAAAAcGCTCTAGTCTATGGAAGCCCTGTATTCGTGATTAATC
TTATTTTACAACTTGAGGAAACTGTGCCTAAAAAGAAAAAGGAGAAGCTATAG(3')AGAACTGTTTTGCGGTTTCGGATAACTCTTTTT
TTTTTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan